KEGG   Anaeromyxobacter sp. K: AnaeK_2822Help
Entry
AnaeK_2822        CDS       T00748                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ank02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ank02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3158644..3159696)
Genome map
AA seq 350 aa AA seqDB search
MSGDGRRRTLRVLVVDDSAASRDELVRMLHGADGLVVAGTAADGEQGLAEALRLAPDVVV
LDLQMPRMDGFSFLRLLMARRPTPVVVLSSQSRRADVFKALELGALDFVARPERGGLGAV
REALLEKCATVRALRIQNLSAGVRALDARELEPARVAVVGASTGGPSALQRLLAALPGDL
PLAVLVAQHMPERFTGAFAERLARGSHFSVVEAVDGDLVVAGRALVAPGGHHLELARGAD
GVLRAAVLPPGAPGPGARHCPSIDRLFRSAARVLGARACAALLTGMGTDGCAGMAAVKAA
GGLTLAESEETAVVYGMPQSAVERGAVDALLGLDALAARLIELAREARAP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgacgggcgccggcgcaccctgcgggtgctggtggtggacgactcggccgcc
agccgggacgagctggtgcgcatgctccacggcgccgacgggctggtggtggccggcacc
gcggcggacggagagcaggggctggccgaggcgctccgcctcgcgccggacgtggtggtg
ctggacctgcagatgccgcggatggacgggttcagcttcctgcgcctgctgatggcgcgc
cgccccacgccggtggtggtgctgtcgtcgcagtcgcggcgcgcggacgtgttcaaggcg
ctcgagctcggggcgctcgacttcgtggcgaggccggagcgcggggggctcggggcggtc
cgcgaggcgctgctggagaagtgcgcgacggtgcgcgcgctgcgcatccagaacctctcc
gccggcgtccgggccctcgacgcccgcgagctcgagccggcccgggtcgcggtggtgggg
gcctccaccggcggcccctccgcgctgcagcgcctgctcgcggcgctgcccggcgatctc
ccgctggcggtgctggtggcgcagcacatgcccgagcggttcaccggcgcgttcgcggag
cggctcgcccgcggctcgcacttcagcgtggtggaggccgtggacggcgacctggtcgtc
gcggggcgcgcgctggtcgcgcccggcgggcaccacctggagctggcgcgcggcgccgac
ggcgtgctgcgggcggcggtgctgccgcccggcgcgccgggccccggcgcgcgccactgc
ccgtccatcgaccggctcttccgctcggcggcgcgggtcctcggcgcccgcgcctgcgcc
gcgctcctcaccgggatgggcaccgacgggtgcgccgggatggcggcggtgaaggccgcc
ggcgggctcacgctcgccgagtccgaggagaccgccgtggtgtacgggatgccgcagtcg
gcggtggagcgcggcgccgtggacgcgctgctcgggctggacgccctggcggcgcgcctg
atcgagctcgcacgcgaggcccgcgcgccatga

DBGET integrated database retrieval system