KEGG   Anaeromyxobacter sp. K: AnaeK_2864Help
Entry
AnaeK_2864        CDS       T00748                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00250  Alanine, aspartate and glutamate metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AnaeK_2864
Enzymes [BR:ank01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AnaeK_2864
Peptidases [BR:ank01002]
 Cysteine Peptidases
  Family C44
   AnaeK_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ACG74088
UniProt: B4UIQ5
Position
complement(3198085..3200121)
Genome map
AA seq 678 aa AA seqDB search
MCGIAGIVSLRDGSPPPGLDELQAMTGALRHRGPDEFGLYRDARAGLGHARLSIIDLATG
QQPLSNEDGTLWIAFNGEIFNYLELREELVALGHRFRTRSDTEVIVHAFEAWGEDAFARF
NGQFAVALWDSARRRLVLARDRVGVRPLYLCEHAGRLWFASEVRALFAGAPDLPRALDPV
GLAETFTFWTVVPPQSVFAGVTELEPGHVRTVSREGTTDRAFWEPSYPAGERGFRGSLDE
AVERVRASLEQAVRLRMLRADVPVGSYLSGGLDSSLVAALGRRVKGDRFCTYSIRFEDAE
YDETAFQRAVAARIESDHREIVVRRADIAEAFPQVVAHAERPLLRTAPAPLFLLSRLVRD
SGIKVVLTGEGADEMFAGYDLFREGKVRRFWGRQPASALRPRLLERLYPYLARSPVAQRA
MAREFFGRGREAPGVPGFAHQTRWQSAAALQRLFTPGVREAARSVDVVARLLRDLPPSFG
AWAALSQDQYLEVRTLLSGYLLSSQGDRMLMAHSVEGRFPFLDADVIELANALPPSFKLR
VLDEKHALKRAAAGLVPPEIVRRPKQPYRAPDALSFVGPGAPGWAAELMSPEGVARAGVF
EPRAVDRLWRKCQASAGGEQLSNADNMAVVGVLSTGLLYDRLVRRAPERTGRLQLTTLVD
RLGERPGLANGFQERQAT
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgccggcatcgtctcgctgcgcgacgggagcccgccgccggggctcgac
gagctccaggcgatgaccggcgcgctgcggcaccgcggccccgacgagttcggcctgtac
cgcgacgcccgcgccggcctcggccacgcgcgcctctcgatcatcgacctcgccaccggg
cagcagccgctctccaacgaggacggcacgctgtggatcgcgttcaacggggagatcttc
aactacctggagctgcgcgaggagctcgtcgcgctcgggcaccggttccggacgcgcagc
gacaccgaggtgatcgtccacgcgttcgaggcgtggggcgaggacgcgttcgcgcgcttc
aacggccagttcgcggtggcgctgtgggactcggcgcgccggcggctggtgctggcgcgc
gaccgggtcggcgtccggccgctctacctctgcgagcacgctgggcggctgtggttcgcg
tccgaggtgcgcgcgctgttcgcgggcgcgccggacctcccgcgcgcgctggacccggtg
ggcctggcggagacgttcacgttctggacggtggtaccgccgcagtcggtgttcgccggc
gtgaccgagctcgagcccggccacgtccgcacggtgtcgcgcgagggcaccaccgaccgc
gcgttctgggagccgtcgtaccccgcaggcgagcgcggcttccgtggctcgctcgacgag
gcggtcgagcgcgtgcgggcgtcgctcgagcaggcggtccggctgcggatgctccgggcc
gacgtgccggtgggcagctacctctcgggcgggctggacagctcgctggtggcggcgctg
ggccggcgcgtgaagggcgaccgcttctgcacgtactcgatccgcttcgaggacgcggag
tacgacgagaccgcgttccagcgggcggtggcggcccggatcgagagcgatcaccgcgag
atcgtcgtccgccgcgccgacatcgccgaggcgttcccgcaggtcgtcgcgcacgccgag
cggcccctgctccggaccgcgccggcgccgctgttcctgctctcgcggctggtgcgcgac
tccgggatcaaggtcgtgctcaccggcgagggcgccgacgagatgttcgccggctacgac
ctcttccgcgagggcaaggtgcgccggttctggggccggcagcccgcgtcggcgctccgc
ccgcgcctgctggagcggctctacccgtatctcgcgcggtccccggtggcccagcgggcc
atggcgagggagttcttcggcaggggccgcgaggcgccgggggtgcccggcttcgcgcac
cagacacgctggcagtcggcggcggcgctccagcggctcttcacgccgggcgtccgcgag
gcggcgcggtcggtggacgtggtggcgcgcctgctccgcgatctgccgccttcgttcggc
gcctgggccgcgctctcgcaggatcagtacctggaggtgcgcacgctgctctcggggtac
ctgctgtcgtcccagggcgatcggatgctgatggcgcactcggtggaggggcgcttcccg
ttcctcgacgcggacgtgatcgagctcgcgaacgcgctcccgccctcgttcaagctccgc
gtgctcgacgagaagcacgccctgaagcgcgccgcggcggggctggtgccgcccgagatc
gtgcgccggcccaagcagccctaccgcgcgcccgacgcgctcagcttcgtcgggcccggc
gcaccggggtgggccgccgagctgatgagcccggagggggtcgcgcgcgccggcgtgttc
gagccgcgtgcggtggaccggctctggcggaagtgccaggcgtccgcgggcggggagcag
ctctcgaacgcggacaacatggcggtggtgggcgtgctgtccacgggcctgctgtacgat
cggctggtgcggcgggcgccggagcgcaccggccggctccagctcacgaccttggtggat
cgcctgggcgagcgccccggccttgcgaacggattccaggagaggcaggcgacatga

DBGET integrated database retrieval system