KEGG   Anaeromyxobacter sp. K: AnaeK_3100Help
Entry
AnaeK_3100        CDS       T00748                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AnaeK_3100
Enzymes [BR:ank01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AnaeK_3100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3467577..3469133
Genome map
AA seq 518 aa AA seqDB search
MRDRRSGILLHPTSLPGPHGAGDLGGAAHRFAGWLADAGQRLWQVLPLGPTGFGDSPYQA
LSSRAGNPLLVSLEVLRNEGWLEDGELAGAPAGEPGRADLHAALEWKRERLARAARAFRA
GADGERAAELEDFRAREGAWLEDWALFAALKAAHGGRPWTAWPAPLARREPRALEAARAR
FADEVFAEVFAQFAFSRQWAALRARCRALGIELMGDLPIYVAHDSAEVWARPELFRLDAS
GEPAVIAGVPPDYFSATGQRWGNPLYDWEAVAREGWRFWIERVRGTLALVDRVRLDHFRG
FEAYWEIPAGAPTAERGRWVPGPGARLFEALLRALGPLPFVAENLGVITPEVEALRRRFG
LPGMAILQFAFGDDPQAPTFQPHNYAPDLVAYTGTHDNDTVAGWWRGGAGDSVRTAEAVA
REKAFALEYLGVDGRDVPGAMIRAVLASVADTAVFPLQDALGLGSEARMNTPATLGGNWR
WRVREEALDAGLADRLRRLATVYGRAPAQAGLRSSNQK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaccgccgctccggcatcctgctccacccgacctcgctgcccggcccccacggc
gcgggcgacctcggcggcgcggcgcaccgcttcgcgggatggctcgccgacgccggccag
cggctgtggcaggtgctgccgctcggcccgaccggcttcggcgactcgccctaccaggcg
ctctcctcgcgcgccggcaacccgctgctggtctcgctggaggtgctccgcaacgagggc
tggctcgaggacggcgagctcgccggcgcccccgccggcgagccggggcgggccgacctc
cacgcggcgctggagtggaagcgcgagcggctggcgcgcgcggcgcgggcgttccgggcc
ggcgccgacggcgagcgcgcggcggagctggaggacttccgcgcgcgcgagggggcgtgg
ctggaggactgggcgctgttcgcggcgctgaaggcggcgcacggcggccggccctggacg
gcctggccggcgccgctcgcccggcgcgagccgagggcgctcgaggcggcgcgggcgcgc
ttcgcggacgaggtcttcgccgaggtgttcgcgcagttcgccttctcccgccagtgggcg
gcgctgcgcgcgcgctgccgcgcgctcgggatcgagctgatgggcgacctgcccatctac
gtggcccacgactcggcggaggtgtgggcccggccggagctgttccggctcgacgcctcc
ggcgagccggcggtgatcgccggcgtcccgccggactacttcagcgccaccggccagcgc
tgggggaacccgctctacgactgggaggcggtggcgcgcgagggctggcgcttctggatc
gagcgcgtgcgcggcacgctcgcgctggtggaccgcgtccggctcgaccacttccgcggc
ttcgaggcctactgggagatccccgccggcgcgcccaccgccgagcgcggccgctgggtg
cccggcccgggcgcgaggctgttcgaggcgctcctccgcgcgctcggcccgctgccgttc
gtggccgagaacctgggcgtcatcacgccggaggtggaggcgctccggcggcgcttcggc
ctgccggggatggccatcctgcagttcgcgttcggggacgacccgcaggcgcccaccttc
cagccccacaactacgcgcccgacctggtcgcgtacaccggcacgcacgacaacgacacc
gtggcgggctggtggcggggcggggcgggcgacagcgtccggacggccgaggcggtggcg
cgagagaaggcgttcgcgctcgagtacctcggggtggacgggcgcgacgtgccgggcgcg
atgatccgcgcggtgctcgcgtccgtcgccgacacggcggtgttcccgctccaggacgcg
ctgggcctcgggtcggaggcgcgcatgaacacgcccgccaccctgggcggcaactggcgc
tggcgggtgcgcgaggaggcgctcgacgccgggctggccgaccggctgcggcggctcgcg
accgtgtacgggcgcgcgcccgctcaggcgggcttgcgcagctcgaaccagaagtag

DBGET integrated database retrieval system