KEGG   Anaeromyxobacter sp. K: AnaeK_3180Help
Entry
AnaeK_3180        CDS       T00748                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ank  Anaeromyxobacter sp. K
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3571922..3573553
Genome map
AA seq 543 aa AA seqDB search
MPGPQPDAPFDYDYLVIGSGFGGSVSALRLAEKGWRVGVLEMGRRWRPEDFPRTNWNLRK
FLWMPRLRLFGIQQITLLKDVLVLHGAGVGGGSLVYANTLLTPPDRAFEDPRWPGGGWRA
RLAPHYAMARFMLGAVEAPEVFPGDEALRQAVDEETGRGHTFSRHTVAVHFGDPKRAAPD
PYFGGEGPARIGCSLCGECMTGCRHGAKNTLDRNYLYLAERRGAEILPETRVTDLHPLAG
GGWEVHTRSSTHVVRRQRRVLRARGVVLAAGAIGTVRLLLRCRAGGSLPALSDQLGNHVR
TNSEALLAVTARRDDVDYSHGLAITSGLQADDDTHMEVVRYGAGHDFMSLLATHLTGGGP
PWPRPLRWLGNLFRHPLDFSRAHWPFGWARRTAVLLVMQPLASHLRLRLARRPWGRSLTS
ALDGPRPPSYMPLANAVARRMAVRMDGVAQSGLHEVFLGASSTAHILGGATMGASPAEGV
CDAQGRVFGYQDLYVADGSLVPANLGVNPSLTITALAEHVMSRIPASPAGAQRPAPRPPG
GAA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcccccagcccgacgcccccttcgactacgactacctcgtgatcggctccggc
ttcggcggctcggtgtccgcgctgcggctggccgagaagggctggcgcgtcggcgtgctc
gagatgggcaggcgctggcggccggaggacttcccgcgcaccaactggaacctgcgcaag
ttcctgtggatgccgaggctgcggctgttcgggatccagcagatcacgctgctgaaggac
gtcctcgtgctgcacggcgcgggcgtgggcggcggcagcctggtctacgcgaacacgctg
ctcacccctccggatcgcgccttcgaggatccgcgctggccgggcggcggctggagggcg
cgcctcgcgccgcactacgcgatggcgaggttcatgctgggcgcggtggaggcgccggag
gtgttcccgggcgacgaggcgctgcgccaggcggtggacgaggagaccgggcgcggccac
acgttctcgcgccacaccgtcgcggtgcacttcggcgacccgaagcgcgccgcaccggac
ccgtacttcggcggcgaagggccggcgcggatcggctgctcgctgtgcggcgagtgcatg
acgggctgccgccacggcgcgaagaacacgctcgaccggaactacctctacctggccgag
cggcgcggcgccgagatcctgcccgagacgcgggtcaccgacctccatccgctcgcgggc
ggaggctgggaggtccacacgcggtcgtccacgcacgtggtccggcgccagcggcgcgtg
ctccgcgcgcgcggcgtggtgctggccgcgggcgcgatcggcacggtgcgcctgctgctc
cgctgcagggcgggcgggagcctgccggcgctctccgatcagctcggcaaccacgtgcgc
accaacagcgaggcgctgctcgccgtcaccgcgcgccgcgacgacgtggactacagccac
gggctcgccatcacctcggggctgcaggcggacgacgacacgcacatggaggtcgtccgc
tacggcgcgggccacgacttcatgtcgctcctcgcgacgcacctcaccggcggcgggccg
ccctggccgcgcccgctgcgctggctcgggaacctgttccggcacccgctggacttctcc
cgcgcgcactggccgttcggctgggcgcggcgcaccgcggtgctgctcgtgatgcagccg
ctcgcgagccacctgcggctgcggctggcgcgccggccgtgggggcgatccctcaccagc
gcgctcgacggcccccgcccgcccagctacatgccgctcgcgaacgcggtggcgcgcagg
atggccgtgcgcatggacggcgtggcgcagagcgggctccacgaggtgttcctgggcgcc
tcgagcaccgcgcacatcctgggcggcgcgacgatgggtgcgtcgccggccgagggcgtc
tgcgacgcgcagggacgcgtgttcggctaccaggacctgtacgtcgccgacggcagcctg
gtgcccgcgaacctgggcgtgaacccgtcgctcaccatcaccgcgctcgccgagcacgtc
atgagccggatccccgccagccccgccggcgcgcagcggccggccccgcgcccgccgggt
ggcgccgcgtga

DBGET integrated database retrieval system