KEGG   Anaeromyxobacter sp. K: AnaeK_3579Help
Entry
AnaeK_3579        CDS       T00748                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00260  Glycine, serine and threonine metabolism
ank00750  Vitamin B6 metabolism
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01120  Microbial metabolism in diverse environments
ank01230  Biosynthesis of amino acids
Module
ank_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AnaeK_3579
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AnaeK_3579
Enzymes [BR:ank01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AnaeK_3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF
Motif
Other DBs
NCBI-ProteinID: ACG74792
UniProt: B4UCF6
Position
complement(4038380..4039660)
Genome map
AA seq 426 aa AA seqDB search
MSSLPAAASPAAPAEAALPGRPALAPLVCRRCGARFDPAPVAVCSECVGPLEPVYETPGA
LPTRAEIEARPRSIWRYRELLPLRSEPVVSLDTGFTPLVDAPALARALGVRRALVKNDAV
SHPTLSFKDRVVAVALNAAVGLGLRTVGCASTGNLANAVAAQAARAGLDAWIFVPEDLEV
GKIVGTAVYGPRLVRVRGTYDDVNRLCAQVADRFGWGLVNLNLRSYYGEGSKTMAFEIAE
QLGWRLPDAVIAPMAGGSLVTKLDKGFHELLGAGLVDGASPRMYGAQAEGCAPIVNLVAS
GGETVTPVVPRTIARSIAIGNPADGVFAARAIRGSGGDAQAVSDAELVDGIRLLARTTGI
FTETAGGVTVVAALRLAGTGKLRPSDELVLCITGNGLKTVEAIQPALPEAPVISPKLREV
AALVDA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgctccctgcggcggcgagccccgccgcgccggcggaggccgccctcccgggc
cgccccgccctcgcccccctggtctgccgccgctgcggcgcgcgcttcgaccccgcgccg
gtggcggtctgttccgagtgcgtcggcccgctcgagccggtctacgagacgccgggcgct
ctcccgacccgcgccgagatcgaggcgcgcccccggtcgatctggcgctaccgcgagctc
ctcccgctccgctccgagccggtggtctcgctcgacaccggcttcaccccgctcgtcgac
gccccggcgctcgcccgcgcgctgggtgtgcgccgcgccctcgtgaagaacgacgccgtc
tcgcacccgacgctctcgttcaaggatcgcgtggtcgcggtggcgctgaacgccgcggtc
gggctcgggctgcgcaccgtgggctgcgcctccaccggcaacctcgcgaacgcggtcgcg
gcgcaggcggcccgcgccggcctcgacgcgtggatcttcgtgccggaggacctcgaggtc
ggcaagatcgtggggacggcggtgtacgggccgcgcctggtgcgcgtccgcggcacctac
gacgacgtgaaccggctctgcgcccaggtggcggaccggttcggctggggcctcgtgaac
ctgaacctgcgcagctactacggcgagggctcgaagaccatggcgttcgagatcgccgag
cagctcggctggcggctgccggacgcggtgatcgcgccgatggccggcggctcgctggtg
acgaagctcgacaagggcttccacgagctgctcggcgccgggctggtggacggcgcctcc
ccgcgcatgtacggcgcgcaggccgagggctgcgcgcccatcgtgaacctggtggcctcg
ggcggcgagaccgtcacgccggtggtgccgcgcaccatcgcgcgctccatcgccatcggc
aacccggccgacggcgtcttcgcggcgcgcgccatccgcggctcgggcggcgacgcgcag
gcggtgtccgacgccgagctggtggacggcatccgcctgctggcccggaccaccggcatc
ttcaccgagaccgccggcggcgtgaccgtggtggccgcgctccggctggcggggacgggc
aagctccgcccctccgacgagctcgtgctctgcatcaccggcaacggcctcaagacggtc
gaggccatccagccggcgctccccgaggcgccggtcatctccccgaagctccgcgaggtc
gcggcgctcgtcgacgcgtga

DBGET integrated database retrieval system