KEGG   Anaeromyxobacter sp. K: AnaeK_3822Help
Entry
AnaeK_3822        CDS       T00748                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ank00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ank00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4302082..4303572
Genome map
AA seq 496 aa AA seqDB search
MRLSTVIAGSGARGDLAGDPEITRVTGDSREVIPGAVFFALPGVQHDGHAFAAEAARRGA
VAVVAERPVECAPARLLLAPSARRAMALAAASFHGRPAERLRMAAVTGTNGKTTVTYLVE
ACARAAAVPVGVLGTISFRFPGADRPASHTTPESTAIQAVLAEMVAAGARDAVMEVSSHA
LAQERVAGIRFQAAGFTNLTRDHLDYHRDMDAYFAAKRRLFTEHLAPGGTAVINARDPWG
ARLADQLGPGPRVWRYGVRAGDALRALEVRTGLAGTSATFETPAGALAIRSPLVGQHNLE
NLLCAAGLALGLGLPPDAVVRGLAASHGAPGRLERIDGRGLSVFVDYAHTDDALARMIAA
LRGLSPRRLICVFGCGGDRDRGKRPLMGAAAAAADLAIVTSDNPRTEDPLAIIADVLPGL
DRAGKPALGAARARTGEDGYLVEPDRRAAIALAVECAREGDAVLVAGKGHEDYQQVGAEK
RPFSDRDEARKALGIA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaggctctccaccgtcatcgccggcagcggcgcccgcggcgatctcgccggcgatccc
gagatcacccgcgtcaccggcgactcgcgggaggtgatcccgggcgcggtgttcttcgcg
ctccccggcgtccagcacgacggccacgccttcgccgccgaggcggcgcggcgcggcgcc
gtcgccgtggtcgccgagcggccggtcgagtgcgcgcccgcgcggctgctgctcgccccg
tccgcgcgccgggccatggcgctcgccgccgccagcttccacggccggccggccgagcgc
ctgcggatggcggcggtcaccggcacgaacgggaagacgaccgtcacctacctggtggag
gcgtgcgcgcgcgccgccgcggtgccggtgggcgtgctcgggacgatctccttccgcttc
cccggcgcggaccggcccgccagccacaccacgccggagtccaccgccatccaggcggtg
ctggcggagatggtcgcggccggcgcgagggacgcggtgatggaggtctcgtcgcacgcg
ctcgcgcaggagcgggtggccgggatccgcttccaggcggccggcttcacgaacctcacg
cgcgaccacctcgactaccaccgcgacatggacgcgtacttcgcggcgaagcgccggctg
ttcaccgagcacctcgcgcccggcggcaccgcggtgatcaacgcgcgcgatccctggggc
gcgcgcctcgccgaccagctcgggccggggccgcgcgtctggcgctacggcgtccgcgcc
ggcgacgcgctgcgcgcgctggaggtgcggaccgggctcgccggcacgagcgcgaccttc
gagacgccggccggcgccctcgcgatccgctcgccgctcgtcggccagcacaacctcgag
aacctgctctgcgccgcgggcctcgcgctcggcctgggcctgccgcccgacgcggtcgtc
cgcggcctggccgcctcgcacggcgcgccgggccggctggagcggatcgacggccgcggc
ctgtcggtcttcgtggactacgcccacaccgacgacgcgctggcgcggatgatcgcggcg
ctgcgcgggctctcgccgcggcggctgatctgcgtgttcggctgcggcggcgaccgggac
cgcggcaagcgcccgctcatgggcgcggcggccgcggccgcggacctcgccatcgtcacc
agcgacaacccgcgcaccgaggacccgctcgccatcatcgccgacgtgctgcccgggctg
gaccgcgccgggaagcccgccctcggcgccgcccgcgcgcggaccggcgaggacggctac
ctggtcgagccggaccgtcgcgccgccatcgcgctcgcggtggagtgcgcgcgcgagggc
gacgcggtgctcgtcgccggcaaggggcacgaggactaccagcaggtgggcgccgagaag
cgccccttctccgaccgcgacgaggcgcgcaaggcgctcgggatcgcatga

DBGET integrated database retrieval system