KEGG   Anaeromyxobacter sp. K: AnaeK_4006Help
Entry
AnaeK_4006        CDS       T00748                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ank01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ank00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ank00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4529574..4531877
Genome map
AA seq 767 aa AA seqDB search
MIRADILDQFPDLFGRKRVNGRELDVDATIETLTRELEPDIEAALTARGALLRSPEPVAT
KYAWPHWNEAFEDPVGGSAWTFRQIVQGMIDNFLGKESPLRWRLNDEVPIPEHVHPSRNP
GLELTGPWHPLDMAFNALNSPAPMNMPDFEDASPPHFRPDGAPAREPVGVFAALKNAKDI
FEGRWSDRAYEVEKKGKVRSYRITAPQAKWPTRLARPPSLHVRYDHVTVDGRPAPGLVVV
ATLWTLNGYDALTRAGSGAYFYIPKLQTPREALIVERLLSRLEGMIGVPAGTLKAKMLYE
EGNAGRQLPAIVWTLRRRLLGTNVGRWDYLGSLIEMWKDDPQGVFPDPQTVGMATPGMLA
YQRYNALLMLMAGMKDGELTHAAPIGGMAAVMIYQAGDPYGRARYNPLALRAMVIDKLRE
RLLGLFFVPDAPLRPGELPTLDAILSGKVRGTLHDAYRQSWVASPEPEYVGAGNGPLRAR
VGALQELLDAAVETVDAGGKPVPTVGSGLSEAERAVFQARGLVDANGRITPFVLAREQVD
APEKLLDRSRWEAIYRVPEGDVTIEHVQHAFYMAANYGFQILNGNFAAAIDDYELKLRFM
NDLATYRINVSWLWALLHHQAPVTKDGHLLRATLTGDGMVLGKPAEAVKAGARLDRALFE
KVYTFHGEWTDAFFAEQDRRGEPARFDRSKAPVIMELLHRQLLSKRYIQHSARALFVIGA
ARPEDRAGLLDAMFDLERADVAARVEKGALPKGALEAHDYVNDVFGG
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgcggacatcctcgaccagttccccgacctgttcggccgcaagcgcgtcaac
gggcgcgagctcgacgtggacgcgaccatcgagacgctcacccgcgagctcgagcctgac
atcgaggccgcgctgaccgcgcgcggcgcgctgctccgctcgcccgagccggtggcgacg
aagtacgcgtggccgcactggaacgaggcgttcgaggatccggtgggcgggagcgcctgg
acgttccggcagatcgtccagggcatgatcgacaacttcctcggcaaggagagcccgctg
cgctggcggctcaacgacgaggtgcccatccccgagcacgtccacccgtcgcgcaacccg
ggcctggagctgaccggcccgtggcacccgctcgacatggcgttcaacgcgctgaacagc
cccgcgccgatgaacatgccggacttcgaggacgcctcgccgccgcacttccgccccgac
ggcgcgcccgcgcgcgagccggtgggcgtgttcgcggcgctcaagaacgcgaaggacatc
ttcgaggggcgctggtccgaccgcgcctacgaggtcgagaagaagggcaaggtccgcagc
taccggatcacggcgccgcaggcgaagtggcccacgcgcctggcgcgcccgcccagcctg
cacgtgcgctacgaccacgtcaccgtggacggccggcccgcgcccggcctggtggtggtc
gcgacgctgtggacgctgaacggctatgacgcgctcacccgcgccggcagcggcgcgtac
ttctacatcccgaagctgcagacgccgcgcgaggcgctcatcgtggagcggctgctgtcg
cgcctggaggggatgatcggcgtgcccgccggcacgctcaaggcgaagatgctctacgag
gaggggaacgccggccgccagctccccgccatcgtgtggacgctgcggcggcggctgctc
ggcacgaacgtcggccgctgggactacctcggcagcctcatcgagatgtggaaggacgat
ccgcagggcgtcttccccgacccgcagaccgtgggcatggcgacgcccgggatgctcgcg
taccagcgctacaacgcgctcctcatgctcatggccggcatgaaggacggcgagctgacc
cacgccgcgcccatcggcggcatggccgcggtgatgatctaccaggccggcgatccgtac
ggccgcgcccgctacaacccgctcgcgctccgcgccatggtgatcgacaagctgcgcgag
cggctgctgggcctgttcttcgtgcccgacgcgccgctccggcccggcgagctgccgacg
ctcgacgcgatcctctccggcaaggtccgcggcacgctgcacgacgcctaccggcagagc
tgggtggcgagccccgagcccgagtacgtcggcgccggcaacggcccgctccgcgcgcgg
gtcggcgcgctgcaggagctgctcgacgcggcggtggagacggtggacgcgggcgggaag
ccggtgcccacggtggggagcgggctctccgaggccgagcgcgccgtgttccaggcgcgc
ggcctggtggacgcgaacgggcgcatcacgccgttcgtgctggcgcgcgagcaggtggac
gcgccggagaagctgctcgaccggtcgcgctgggaggccatctaccgggtgcccgagggc
gacgtcaccatcgagcacgtgcagcacgcgttctacatggcggcgaactacggcttccag
atcctgaacggcaacttcgccgccgcgatcgacgactacgagctgaagctccgcttcatg
aacgacctcgccacctaccgcatcaacgtgtcctggctgtgggcgctcctgcaccaccag
gcgcccgtcacgaaggacggccacctgctccgcgccacgctcaccggggacggcatggtg
ctcggcaagcccgccgaggcggtgaaggccggggcgcgcctcgatcgcgcgctgttcgag
aaggtgtacacgttccacggtgagtggacggacgcgttcttcgccgagcaggaccgccgc
ggcgagcccgcgcgcttcgaccgctccaaggcgccggtgatcatggagctgctgcaccgc
cagctcctgtccaagcgctacatccagcacagcgcccgcgcgctgttcgtgatcggcgcc
gcccgccccgaggaccgcgccggcctgctcgacgcgatgttcgacctcgagcgcgccgac
gtcgccgcgcgcgtggagaagggcgcgctgccgaagggcgcgctcgaggcgcacgactac
gtgaacgacgtgttcggggggtag

DBGET integrated database retrieval system