KEGG   Anaeromyxobacter sp. K: AnaeK_4171Help
Entry
AnaeK_4171        CDS       T00748                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AnaeK_4171
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AnaeK_4171
Enzymes [BR:ank01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AnaeK_4171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4707571..4708353
Genome map
AA seq 260 aa AA seqDB search
MTVLDGILARKVDEVAARRAAVPDAALAARAAAAPPPRAFEAALSPRGGPLRVIAEVKRA
SPSAGAIRAGLDAVAQARRYAAAGAAAISVLTDGPGFGGSLDDLVAVRAAVDVPLLRKDF
VVDRYQLLEARAAGADAALLIVAGLAQDDLRRLLDGCGELGLAALVEVHDDAEAERALAA
GARIVGVNNRNLHTFHVDLATSERILPSLPAAVKGVAESGVRGPEDAARLRRAGAANLLV
GEALVRAEDPAALLRALGEA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcctcgacggcatcctggcccggaaggtggacgaggtggccgcccgccgcgcg
gccgtgccggacgccgcgctggccgcccgcgccgccgccgccccgccgccgcgcgcgttc
gaggccgcgctctccccccgcggcggcccgctgcgcgtcatcgccgaggtgaagcgcgcc
agcccgtccgccggcgccatccgcgccggcctcgacgcggtggcccaggcgcgccgctac
gccgccgcgggcgccgccgccatctcggtgctcaccgacggccccgggttcggcggctcg
ctcgacgacctggtggcggtgcgcgccgcggtggacgtgccgctgctccgcaaggacttc
gtggtggaccgctaccagctcctcgaggcccgcgccgccggggcggacgcggcgctgctc
atcgtggccgggctcgcgcaggacgacctgcggcggctgctggacggctgcggcgagctg
gggctcgcggcgctggtcgaggtccacgacgacgccgaggccgagcgcgcgctcgcggcc
ggcgcgcgcatcgtgggcgtcaacaaccgcaacctgcacaccttccacgtggacctcgcc
acctccgagcgcatcctgccgtcgctccccgcggcggtgaagggcgtggcggagagcggc
gtgcgcgggccggaggacgcggcccggctgcgccgcgccggggccgcgaacctgctggtg
ggcgaggcgctggtgcgcgccgaggacccggccgcgctgctgcgcgcgctgggcgaggcg
tga

DBGET integrated database retrieval system