KEGG   Anaeromyxobacter sp. K: AnaeK_4174Help
Entry
AnaeK_4174        CDS       T00748                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00260  Glycine, serine and threonine metabolism
ank00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ank01100  Metabolic pathways
ank01110  Biosynthesis of secondary metabolites
ank01130  Biosynthesis of antibiotics
ank01230  Biosynthesis of amino acids
Module
ank_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ank00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AnaeK_4174
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AnaeK_4174
Enzymes [BR:ank01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AnaeK_4174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth B12-binding BtpA PcrB DUF4928
Motif
Other DBs
NCBI-ProteinID: ACG75377
UniProt: B4UHD5
Position
4710268..4711125
Genome map
AA seq 285 aa AA seqDB search
MSPRPARKPRAAAAPAAAERPDRISAAFERCRAERRAALVTYVMGGDPDLATARQMALAC
VEGGADLVELGVPFSDPIADGPTIQAAAQRALGAGTTLEDVLGIAAAVRARSQVPIALMG
YLNPMLAGGVEKLVRGCADAGVDALIIPDLLPEEAEVLAPAAEAAGVKLVYLLAPTSNAA
RVEAAARAATGFLYFVSVTGVTGARHAVAEEIAPLVSAVRARTELPVVIGFGVASPEQAR
ALGPLADGVVVGSAIVQRIAEGGSRRARAERVTRFVRSLGRALRR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcgccccgcccgcaagcctcgcgccgccgccgcgcccgccgcggccgagcgc
cccgaccgcatctcggccgcgttcgagcgctgccgcgccgagcgccgcgccgcgctcgtc
acctacgtgatgggcggcgatcccgacctcgccaccgcccgccagatggcgctcgcctgc
gtcgagggcggcgccgacctcgtcgagctgggggtgccgttctcggatcccatcgccgac
ggccccaccatccaggccgccgcgcagcgcgcgctcggcgccggcaccacgctcgaggac
gtgctcgggatcgcggccgcggtccgcgcgcgctcgcaggtcccgatcgcgctcatgggc
tacctcaaccccatgctggccggcggcgtcgagaagctggtgcgcggctgcgccgacgcc
ggcgtggacgcgctcatcatcccagacctgctgcccgaggaggccgaggtgctcgccccc
gcggcggaggcggccggcgtgaagctggtctacctgctcgcgcccacctcgaacgcggcg
cgcgtcgaggccgcggcccgggccgccaccggcttcctctacttcgtgtcggtgaccggc
gtgaccggcgcgcgccacgcggtggcggaggagatcgcgccgctcgtgtcggcggtgcgg
gcccggaccgagctgccggtggtcatcggcttcggcgtggcctcgcccgagcaggcgcgc
gcgctcggcccgctcgcggacggcgtggtggtcgggagcgcgatcgtgcagcggatcgcg
gagggcggctcgcgacgcgcccgcgccgagcgggtgacgcggttcgtgcgatcgctgggg
cgcgcgctgcggcgctga

DBGET integrated database retrieval system