KEGG   Anaeromyxobacter sp. K: AnaeK_4226Help
Entry
AnaeK_4226        CDS       T00748                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ank  Anaeromyxobacter sp. K
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ank00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4756972..4758084
Genome map
AA seq 370 aa AA seqDB search
MNLTDTLALLLRPAGGGIHLVSSGKAEQLALQRRLYGADDEREIRARWREDLERAATARA
VVLGIPSDVGAGFRRGANLGPAAIRERLLADDPSRSARDRADGVVDLGDVFVVPQLLHDD
MLGEAQLAASRRALYPDLPADEAARLPVSPLSIAEHALSLVLEVNPRARVFAVGGDHSTA
WPVVKALSARWPGLGIVQIDAHTDLLEDRLGIRYCFGTWSYHANELVGRGGRLVQVGTRA
SGRDRAHWESTLGVRQFWAADVLADPRAALDAILAHVKATGVSSVYFSNDIDGTDQQWAD
ATGTPEPGGLTPAFVSALVRRLGSEVGLAGGDVMEVAPGIAGGEGAGPRTVGLAAGYLAE
TIDAALGRTR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctcaccgacacgctcgcgctcctcctccgccccgccggcggcggcatccacctc
gtctccagcggcaaggccgagcagctcgcgctgcagcgccggctctacggcgccgacgac
gagcgcgagatccgcgcgcgctggcgcgaggacctggagcgcgccgccaccgcgcgcgcg
gtggtgctgggcatcccctccgacgtgggggcgggcttccgccgcggcgcgaacctgggc
ccggccgccatccgcgagcggctgctcgccgacgatccgtcgcgcagcgcgcgcgaccgc
gccgacggggtggtggacctcggcgacgtgttcgtggtcccgcagctcctccacgacgac
atgctgggcgaggcgcagctcgccgccagccgccgcgcgctctacccggacctgccggcg
gacgaggcggcgcgcctgccggtgtcgccgctgtccatcgcggagcacgcgctgtcgctg
gtgctggaggtgaacccgcgcgcccgcgtgttcgcggtcggcggcgatcactccaccgcg
tggccggtcgtgaaggcgctctcggcgcgctggccgggcctcggcatcgtgcagatcgac
gcccacaccgacctgctcgaggaccggctcggcatccgctactgcttcggcacctggtcg
taccacgcgaacgagctggtgggccgcggcgggcggctcgtgcaggtgggcacgcgcgcc
tcggggcgcgaccgcgcgcactgggagtccacgctgggcgtgcggcagttctgggcggcc
gacgtgctcgccgatccgcgcgcggcgctggacgcgatcctggcgcacgtgaaggcgacc
ggcgtgtcctcggtgtacttcagcaacgacatcgacggcaccgatcagcagtgggccgac
gccaccggcacgcccgagccgggcggcctcaccccggcgttcgtctcggcgctcgtccgg
cggctgggcagcgaggtggggctcgcgggcggcgacgtgatggaggtcgcgccggggatc
gcgggcggcgagggcgcggggccgcgcacggtggggctcgccgcgggctacctcgccgag
accatcgacgcggcgctgggccggacccggtga

DBGET integrated database retrieval system