KEGG   Arcobacter nitrofigilis: Arnit_0104Help
Entry
Arnit_0104        CDS       T01235                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00010  Glycolysis / Gluconeogenesis
ant00030  Pentose phosphate pathway
ant00051  Fructose and mannose metabolism
ant00052  Galactose metabolism
ant00230  Purine metabolism
ant00500  Starch and sucrose metabolism
ant00520  Amino sugar and nucleotide sugar metabolism
ant00521  Streptomycin biosynthesis
ant01100  Metabolic pathways
ant01110  Biosynthesis of secondary metabolites
ant01120  Microbial metabolism in diverse environments
ant01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arnit_0104
   00030 Pentose phosphate pathway
    Arnit_0104
   00051 Fructose and mannose metabolism
    Arnit_0104
   00052 Galactose metabolism
    Arnit_0104
   00500 Starch and sucrose metabolism
    Arnit_0104
   00520 Amino sugar and nucleotide sugar metabolism
    Arnit_0104
  Nucleotide metabolism
   00230 Purine metabolism
    Arnit_0104
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arnit_0104
Enzymes [BR:ant01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Arnit_0104
    5.4.2.8  phosphomannomutase
     Arnit_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADG91773
UniProt: D5V3R2
Position
complement(92982..94382)
Genome map
AA seq 466 aa AA seqDB search
MINKSIFREYDIRGIVGNELNEQSSKLIGYYLGLEAIKRTNVQEPVVVIGYDARIHSPEL
FNYLTSGFNKAGCKVLGMGMVATGVNYFASFQEFDGEKPNASVMITGSHNPSPYNGFKIT
INNAPFFGDDIYAMGEEIINNQNMNIKDNETYKEIDVKSLYKNYMITEFAHLKGMKQKLI
IDCGNGVADTVLTDILDALELNYDALYCEPDGTFPNHHPDPSEEKNLKDVIEKLKGDYEY
GFAYDGDADRIAFLTKNHNVKGDIMALLFAKTMKNPVIIGEVKCTQIMYDRINENGTAVM
YKTGHSNLKVKLKELNADMAAEVSGHIFFNDRYYGFDDAIYATFRLLELIFNGMDIDKEI
DSLPKVYSTEEIKVETTEEEKFLLMHQIKKNLITVGDDFPKILDIIEVDGVRIVFEQGWG
LVRASNTTPVLVTRFESTDLEVAKLYENKINELILRSKNELSNTTN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaagtatttttagagagtatgatattagaggaattgtaggaaatgaacta
aatgaacaaagttcaaaactcataggttactatttgggcttagaagctataaaaagaaca
aatgtgcaagaaccagttgtggtaattggatatgatgcaagaattcattctcctgaacta
tttaattatttaacctctggatttaacaaagctggttgcaaagttttaggtatgggaatg
gttgcaacaggagttaattattttgcttcttttcaagagtttgatggggaaaagccaaat
gcctcagttatgataacaggtagccacaatccaagtccttataatggctttaaaataact
attaacaatgcaccattttttggtgatgatatttacgctatgggtgaagagattattaat
aatcaaaatatgaacattaaagataatgaaacttataaagaaatagatgtaaaaagttta
tataagaactatatgataacagaatttgcccacctaaaaggtatgaaacaaaagcttatt
attgattgtgggaatggagttgcggatactgttttaacggatattttagatgccttagaa
ctaaattatgatgcactatattgtgaaccagatggaacttttccaaatcaccatccagat
ccaagtgaagaaaaaaacctaaaagatgttattgaaaaattaaaaggtgactatgaatat
ggttttgcttatgatggagatgctgataggatcgcatttttgactaaaaatcataatgta
aaaggcgatattatggcattactttttgcaaaaactatgaaaaacccagtaatcattggt
gaagtaaaatgtactcaaatcatgtatgatagaatcaatgaaaatggcactgctgttatg
tataaaacaggtcattcaaacttaaaagtaaaattaaaagagttaaatgcagatatggca
gcagaagtatcaggacacatcttttttaatgatagatattatggttttgatgatgctatt
tatgctacatttagacttttagaacttatttttaatggcatggatatagataaagagata
gactcattaccaaaggtatattcaacagaagagataaaagtagagacaacagaagaagaa
aaatttcttttaatgcaccaaattaaaaagaatctaatcaccgtaggagatgactttcct
aaaatcttagatatcatagaggtagatggagtgagaattgtctttgaacaaggttggggc
ttggtaagagcttcaaatacgacgccagtacttgtgactagatttgagtcaacagacctt
gaagttgcaaagctttatgaaaacaaaataaatgaattaattttaagaagtaaaaatgaa
cttagtaacactacaaattaa

DBGET integrated database retrieval system