KEGG   Arcobacter nitrofigilis: Arnit_0138Help
Entry
Arnit_0138        CDS       T01235                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ant  Arcobacter nitrofigilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ant00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
129538..131319
Genome map
AA seq 593 aa AA seqDB search
MCGILGSNFISNNFDSALSLMNNRGPDYSKVFAHKNYQFGHTRLSIIDVDDEANQPMIFD
DILIVFNGEIYNYKELIKSENLLCSTSSDTEVIIRLYQKYGIDFLNKLNGMFSFVIFDLK
QEKYFCARDRYGKKPFFYYFKDNKFIFSSSIKSIIKILGFTPKLNKVALSQYLQYFVSLN
DMTFYNDINKLEASSYMLLSSNELFIKKYYKINTYKKVVDEKQALNDIEELLFKSVESRL
VGDVEVGSLLSGGIDSSFISSLYTNITGKRINTFSVGYSDHISYSELDYASLVSKDINSI
HHPLEVSRNDFIDVFDEVIDALEEPHADSAAFPLYCLTKLINKKGIKVVLSGEGSDELFL
GYDNYSKFLKYYKFKESLSADQDGFLKDIISALQNNTKESEYLRRVVTDENIYNSFGEIY
TTIQKKRLFKRLPTFKQEKAKKDPVDWMSYIDLKIWLGQSLLSKVDRISMANSIEVRTPF
LDFRLVDYLFSVDTKLKTGDTNKYLLKKIASKYIPEKIINRTKKGFNSPYNEWIFNSHGE
DLLKTILNVNYQTNLFNEDYVIMIYNLAKKNKFKQHFWSLYIFSYWFNKNYLI
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatattaggttctaattttatttcgaataattttgatagtgctttatctctt
atgaataatagaggtccagattattctaaggtttttgctcacaaaaactatcaatttggt
catacaagattgtctataattgatgtggatgatgaagccaatcagcctatgatatttgat
gatattttgattgttttcaatggtgagatatataactataaagagttaattaaaagtgaa
aatcttctttgtagtacatcatctgatacagaagttataataagattatatcagaagtat
ggaattgattttttaaataaattaaatggcatgttctccttcgtaatttttgatttaaaa
caagaaaaatacttttgtgctagggatagatatgggaagaaaccattcttttattatttc
aaagataataaatttatcttctcttcttctattaaatctataataaaaatattaggtttt
actcccaaattaaataaagttgctttatctcaatatttgcaatattttgtttcattaaat
gatatgactttttataatgatattaataaattagaagcctcttcttatatgcttctttct
agtaatgaattatttataaaaaaatattacaaaatcaatacttacaaaaaagttgttgat
gagaaacaagctttaaatgatatagaagagcttttatttaaaagtgttgaatcaagactt
gtaggtgatgtggaagtagggagcttattaagtggaggaattgatagttcatttatatct
tctttgtatacaaatatcacaggaaagcgtatcaatactttctctgtaggatatagtgac
catataagctattctgagcttgattatgcttctttagtatcaaaagatattaattctata
catcatcccttagaggtatctagaaatgactttattgatgtctttgatgaagttattgat
gccctagaagaaccccatgctgatagtgctgctttccctttatattgtcttacaaaacta
attaataaaaaaggaataaaagttgttttaagcggtgagggtagtgatgaacttttttta
ggatatgataattattcaaaatttctaaaatactataagtttaaagagtctttatcagct
gatcaagatggatttttaaaagatattatctccgctttgcaaaacaatactaaagagagt
gaatacttacgaagagtggttactgatgaaaatatttacaactcttttggtgagatatat
actactatacaaaaaaaacgtttatttaaacgacttcctactttcaaacaagaaaaagca
aaaaaagatcctgttgattggatgagttatattgatctcaaaatttggttaggtcagtca
ttactttctaaagttgatagaatttccatggcaaactctattgaggtaagaacaccgttt
ttagattttaggttagttgattatttatttagtgttgatactaaattaaaaactggagat
acaaataaatatttgttaaaaaagattgctagtaaatatattccagaaaaaattatcaat
agaactaaaaaaggatttaactctccatataatgaatggatttttaatagtcatggtgaa
gacttattaaaaactattcttaatgttaattatcaaacaaatttattcaatgaagattat
gttattatgatttataatcttgctaaaaagaataaattcaaacaacatttttggtctttg
tatattttttcttactggttcaacaaaaattatcttatttaa

DBGET integrated database retrieval system