KEGG   Arcobacter nitrofigilis: Arnit_0212Help
Entry
Arnit_0212        CDS       T01235                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ant  Arcobacter nitrofigilis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Arnit_0212
Enzymes [BR:ant01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Arnit_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198617..200365
Genome map
AA seq 582 aa AA seqDB search
MKGPKHISDPKHTINKRLHRLYPEEIAQRAVNDIIDLIFKYKQRIKPSDYRLSQKDIILI
TYGDQVSKLHEPSLETLNNFMNDHLKGVINSIHILPFYPYSSDDGFSVVNYNAVDPHMGS
WREIESISKDYRLMVDGVINHISQFSDWFKAYLAGDPYFQDFFINVDPSIDLSKVVRPRA
TPLLSEFIDDEGKIKNIWTTFSKDQVDLNYKSHRVLRNVLDALFYYIEKGATLIRLDAIA
FIWKEIGTSCVHLPQTHELIQLMREVLHEVAPEVIIITETNVPHNENISYFGSGEDEAQM
VYNFALPPLLLHSILNSNTKKLTAWAKTLTLPSDKVCFFNFTASHDGIGMRPIKGILEDE
EIENLVKTVEDHGGLVSYRAEEDGSQTPYELNCSYIDALTHPKEDQYLRVKRMLVTQAAV
LAMPGVPGIYFHSLVGSKNYHDGVKHTGVNRTINREKYNIDWLENELSSQGTLAKTMFDS
YKRLISIRISEEAFNPFGEFEILDLDDRLFVIDQSCCGNENRIVAIHNFSNEEVMCKLPV
SISLPLCDILSSNCMSKNEEKTEKMNEIKLEPYQIMWLKGKI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaccaaaacatatatcagatcccaaacatactataaataaaagacttcatcgt
ttatatccagaagagatagcacaaagggctgtaaatgatatcattgatttaatttttaaa
tataaacaaagaattaaaccaagtgattatcgtctaagccaaaaagatattattttgata
acttatggtgaccaagtatcaaaactccatgagccatctttagagactttgaataatttt
atgaatgaccatctaaaaggtgtaataaattctattcatattttacccttttatccatat
tcaagtgatgatggcttttcagttgttaattataatgccgttgatcctcatatgggttca
tggagagaaattgagtcaataagtaaagattatagacttatggtagatggagttataaat
catatctctcaattttctgattggtttaaagcctatttagcaggtgatccatattttcaa
gacttttttatcaatgttgatccttcaattgatttaagtaaggttgttcgtcctagagca
acgccgctattaagtgaatttattgatgatgagggaaagataaaaaatatctggacaacc
tttagtaaagaccaagttgatttaaactacaaaagtcatagggtcttacgaaatgttttg
gatgcacttttttattatatagaaaaaggggcaacactaattagacttgatgccatagcc
tttatttggaaagagatagggacctcttgtgttcatcttccccaaacccatgaactaata
caactcatgcgtgaggttttacatgaagtagcacctgaagttattattatcacagaaaca
aatgttcctcacaatgaaaatatttcatactttgggagtggagaagatgaggctcagatg
gtatataactttgctttgcctcctttattattacactcaattctaaactcaaatactaaa
aaactaactgcatgggcgaaaactttaactcttcctagtgataaggtttgtttttttaac
tttactgcaagccatgatgggataggtatgcgtcctataaaaggtattttagaagatgaa
gagattgaaaatctagtaaaaactgtagaagaccatgggggattagtatcttatagagca
gaagaagatggaagtcagactccatatgaattaaactgctcttatatagatgctcttact
cacccaaaagaagaccaatacctaagagtaaaaagaatgttagtaactcaagcagctgtt
ttagcaatgccaggtgttccaggaatttattttcactctttggtgggttctaaaaattat
catgatggggttaaacatacaggtgtaaatcgtacaataaatagagaaaaatataatatt
gattggttggaaaatgaactttcaagtcaaggaactcttgcaaaaacaatgtttgattca
tataaaagacttatatctatacgaataagtgaagaagcatttaatccatttggagagttt
gaaattctagatttagatgatagactttttgttatagatcaatcttgttgtggtaatgaa
aatagaattgtagcaatacataatttctcaaatgaagaggttatgtgtaagttacctgtt
tctatttccttaccactttgtgatatactttcttcaaactgtatgtcaaaaaatgaagaa
aaaacagaaaaaatgaatgaaataaaattagagccatatcaaattatgtggctaaaaggc
aaaatttaa

DBGET integrated database retrieval system