KEGG   Arcobacter nitrofigilis: Arnit_0212Help
Entry
Arnit_0212        CDS       T01235                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
ant  Arcobacter nitrofigilis
Brite
Enzymes [BR:ant01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Arnit_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADG91878
UniProt: D5V4E5
Position
198617..200365
Genome map
AA seq 582 aa AA seqDB search
MKGPKHISDPKHTINKRLHRLYPEEIAQRAVNDIIDLIFKYKQRIKPSDYRLSQKDIILI
TYGDQVSKLHEPSLETLNNFMNDHLKGVINSIHILPFYPYSSDDGFSVVNYNAVDPHMGS
WREIESISKDYRLMVDGVINHISQFSDWFKAYLAGDPYFQDFFINVDPSIDLSKVVRPRA
TPLLSEFIDDEGKIKNIWTTFSKDQVDLNYKSHRVLRNVLDALFYYIEKGATLIRLDAIA
FIWKEIGTSCVHLPQTHELIQLMREVLHEVAPEVIIITETNVPHNENISYFGSGEDEAQM
VYNFALPPLLLHSILNSNTKKLTAWAKTLTLPSDKVCFFNFTASHDGIGMRPIKGILEDE
EIENLVKTVEDHGGLVSYRAEEDGSQTPYELNCSYIDALTHPKEDQYLRVKRMLVTQAAV
LAMPGVPGIYFHSLVGSKNYHDGVKHTGVNRTINREKYNIDWLENELSSQGTLAKTMFDS
YKRLISIRISEEAFNPFGEFEILDLDDRLFVIDQSCCGNENRIVAIHNFSNEEVMCKLPV
SISLPLCDILSSNCMSKNEEKTEKMNEIKLEPYQIMWLKGKI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaccaaaacatatatcagatcccaaacatactataaataaaagacttcatcgt
ttatatccagaagagatagcacaaagggctgtaaatgatatcattgatttaatttttaaa
tataaacaaagaattaaaccaagtgattatcgtctaagccaaaaagatattattttgata
acttatggtgaccaagtatcaaaactccatgagccatctttagagactttgaataatttt
atgaatgaccatctaaaaggtgtaataaattctattcatattttacccttttatccatat
tcaagtgatgatggcttttcagttgttaattataatgccgttgatcctcatatgggttca
tggagagaaattgagtcaataagtaaagattatagacttatggtagatggagttataaat
catatctctcaattttctgattggtttaaagcctatttagcaggtgatccatattttcaa
gacttttttatcaatgttgatccttcaattgatttaagtaaggttgttcgtcctagagca
acgccgctattaagtgaatttattgatgatgagggaaagataaaaaatatctggacaacc
tttagtaaagaccaagttgatttaaactacaaaagtcatagggtcttacgaaatgttttg
gatgcacttttttattatatagaaaaaggggcaacactaattagacttgatgccatagcc
tttatttggaaagagatagggacctcttgtgttcatcttccccaaacccatgaactaata
caactcatgcgtgaggttttacatgaagtagcacctgaagttattattatcacagaaaca
aatgttcctcacaatgaaaatatttcatactttgggagtggagaagatgaggctcagatg
gtatataactttgctttgcctcctttattattacactcaattctaaactcaaatactaaa
aaactaactgcatgggcgaaaactttaactcttcctagtgataaggtttgtttttttaac
tttactgcaagccatgatgggataggtatgcgtcctataaaaggtattttagaagatgaa
gagattgaaaatctagtaaaaactgtagaagaccatgggggattagtatcttatagagca
gaagaagatggaagtcagactccatatgaattaaactgctcttatatagatgctcttact
cacccaaaagaagaccaatacctaagagtaaaaagaatgttagtaactcaagcagctgtt
ttagcaatgccaggtgttccaggaatttattttcactctttggtgggttctaaaaattat
catgatggggttaaacatacaggtgtaaatcgtacaataaatagagaaaaatataatatt
gattggttggaaaatgaactttcaagtcaaggaactcttgcaaaaacaatgtttgattca
tataaaagacttatatctatacgaataagtgaagaagcatttaatccatttggagagttt
gaaattctagatttagatgatagactttttgttatagatcaatcttgttgtggtaatgaa
aatagaattgtagcaatacataatttctcaaatgaagaggttatgtgtaagttacctgtt
tctatttccttaccactttgtgatatactttcttcaaactgtatgtcaaaaaatgaagaa
aaaacagaaaaaatgaatgaaataaaattagagccatatcaaattatgtggctaaaaggc
aaaatttaa

DBGET integrated database retrieval system