KEGG   Arcobacter nitrofigilis: Arnit_0213Help
Entry
Arnit_0213        CDS       T01235                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ant  Arcobacter nitrofigilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Arnit_0213
   00052 Galactose metabolism
    Arnit_0213
   00500 Starch and sucrose metabolism
    Arnit_0213
   00520 Amino sugar and nucleotide sugar metabolism
    Arnit_0213
Enzymes [BR:ant01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Arnit_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200387..201238
Genome map
AA seq 283 aa AA seqDB search
MNAKDKTITSCLFPAAGYGTRFLPATKAMPKEMLPVLTKPLIQYGVEEAMEAGCDIMSVI
TGRGKRAITDHFDISYELEHQIQGSSKEKMLADIRNIIDKCTFTYTRQNEMKGLGDAIYK
GKVLVGDINPFAVILADDLCVNPKGDGILAQMVKLYNKYKCCIVACMEVPKEDVHKYGVI
EGNQIEDGVFMVSNMVEKPDNDKAPSNLAVIGRYILTPDIFEVIQNTKPGKNGELQITDA
LCTQAKKGMVMAYKFQGKRFDCGSVDGFVEATNYFYNLENKKK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctaaagataaaacaataacaagttgtctatttccagcagctggatatggaaca
agatttcttccagcaacaaaagctatgccaaaagagatgttaccagttcttacaaaaccc
ttgattcagtatggagttgaagaggcgatggaagctggttgcgacattatgtctgttatt
acagggcgagggaaaagagctataacagatcattttgatatctcttatgagttagaacac
caaatacaaggttcatcaaaagagaaaatgttagctgatattagaaatattattgataaa
tgtacatttacttatactagacaaaatgagatgaaaggtttaggagatgctatttataag
ggtaaagttttagtaggagacattaatccttttgcagtaatccttgcagatgacctttgt
gtaaatccaaagggtgatggtattttagctcaaatggtaaaactttataataaatataaa
tgttgtatcgtagcttgtatggaagtacccaaagaagatgtacataaatatggggtaata
gaaggtaatcaaatagaagatggtgtttttatggtatcaaatatggttgaaaagcctgat
aatgataaagctccatcaaatttagctgttataggaagatatattttaacaccagatatt
tttgaagtaattcaaaatacaaaacctggtaaaaatggagagttacaaattactgatgct
ttatgtacacaagcaaaaaaaggtatggtaatggcttataaattccaaggaaaaagattt
gattgtggtagtgttgatggttttgttgaagctacaaactatttttataatttagagaat
aaaaagaaataa

DBGET integrated database retrieval system