KEGG   Arcobacter nitrofigilis: Arnit_0285Help
Entry
Arnit_0285        CDS       T01235                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:ant01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ant00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ant00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ant00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ant00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ant00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:ant00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:ant00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(272932..274161)
Genome map
AA seq 409 aa AA seqDB search
MNSKQMELNKVEVWDGNTCNAQAFRQAAVDVLAAYPITPSTNTVETYASFHANGYVDGEI
IMVESEHAAMSGCVGAGAAGGRVATATSSQGCALMVEVLYQCSGMRIPVVLCLVNRALAA
PLNVNGDHSDMYLTRDAGWIQLDSFNAQEAYDLTLCSFKIGEHKDVRLPVISNQDGFLTS
HTAQTVRPLSDKVAYDFVGDYLQVNAMLDFTNPVTHGVQTEHDWHFEHKAKQHAALMGSL
FVVEEVFEEFEKISGRKYNLVESYKVEDADVVIVCLGTTYETAMIAVDAIREETGIKAGV
LAPRLFRPFPLTQLASKLQNVKAIACMDRSAPGGTVGTLYNEVAGALFNTQARPILKNLV
YGLGGRDIIVNELKEIFVSLNEEAKNGKLNGKIQTLHGVRGPELSFYEH
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcaaacaaatggaactaaataaagtagaagtttgggatgggaatacctgtaat
gctcaagcatttagacaagcagctgttgatgtacttgctgcttatcctataacaccttca
acaaatacagttgaaacttatgcttcttttcatgcaaatggatatgtggatggtgaaatc
attatggtggaatctgagcatgctgcaatgtctggttgtgttggtgcaggagctgctggt
ggaagagtagcaactgctacttcatcacaaggttgtgctttgatggtagaagttttatat
caatgttctggtatgagaatccctgttgttttatgtttagtaaatagagcattagcagca
cctttaaatgtaaatggtgaccattcagatatgtaccttacaagagatgcaggctggatt
caactagactcatttaatgcacaggaagcttatgatttaacactatgttcttttaaaatc
ggtgagcacaaagatgtaagacttccagttatctctaatcaagatggatttttgacttct
catacagcccaaacagtaagaccactgtctgataaagtggcttatgattttgtaggtgac
tatttgcaagttaatgcaatgttggattttacaaaccctgttactcatggagttcaaaca
gagcatgactggcactttgaacataaagctaaacaacatgcagccctaatgggttcactt
tttgttgtggaagaagtttttgaagagtttgaaaaaattagtggaagaaaatataatctt
gtagaatcatataaagtagaagatgcagatgttgtaattgtatgtttaggaactacttat
gaaacagcaatgatagcagttgatgccataagagaagaaacaggaataaaagctggtgtt
ttagcaccaagactttttagaccatttcctcttacacaattggcttcaaaattacaaaat
gtaaaagctatagcatgtatggatagaagtgcacctggtggaacggttggaactttatac
aatgaagttgcgggagccttatttaatacccaagctagaccaattctgaaaaacttagta
tatggtttaggtggaagagatattattgtaaatgaattaaaagagatttttgtctcttta
aatgaagaagcaaaaaatggaaaacttaatgggaaaattcaaacacttcatggtgtaaga
ggtcctgagttaagtttttatgaacactaa

DBGET integrated database retrieval system