KEGG   Arcobacter nitrofigilis: Arnit_0287Help
Entry
Arnit_0287        CDS       T01235                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arnit_0287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arnit_0287
   00020 Citrate cycle (TCA cycle)
    Arnit_0287
   00620 Pyruvate metabolism
    Arnit_0287
   00640 Propanoate metabolism
    Arnit_0287
   00650 Butanoate metabolism
    Arnit_0287
  Energy metabolism
   00680 Methane metabolism
    Arnit_0287
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arnit_0287
Enzymes [BR:ant01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arnit_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(274585..275148)
Genome map
AA seq 187 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLGSVVAETGKEVQAFAFYGSAKRGASMTAYNRIDDKQIIN
HEKFMEPNFVFILDPALAFTDDFTANETEDTKYIITTHLSKEELIEAIPALHGRENRTFI
LDCLQISQETIGRPIPNTPMLGAFMKVSGMFELDYFQNAMKSVLKKLPQKIIDANMIAIE
RAYNEVH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattagatggcacagtagagcaggacaaggggcggttactggtgcaaaaggt
ctaggttcagttgtagcagaaacggggaaagaagttcaagcttttgcattttatggatct
gcaaaaagaggtgcttctatgactgcttataacagaatagatgacaaacaaatcataaac
catgagaaattcatggaaccaaactttgtatttatattagacccagcattagcatttaca
gatgactttacagctaatgaaactgaagatactaaatacataatcacaacacaccttagt
aaagaagagttaatagaagcaattccagctttacatggtagagaaaacagaacatttata
ctagattgtttgcaaatttctcaagaaacaataggaagacctattccaaatacaccaatg
cttggggcatttatgaaagtaagtggtatgtttgaattggattatttccaaaatgcgatg
aaatcagtgcttaaaaaacttcctcaaaagataatcgatgcaaatatgattgctattgag
agagcatacaatgaagtacattaa

DBGET integrated database retrieval system