KEGG   Arcobacter nitrofigilis: Arnit_0325Help
Entry
Arnit_0325        CDS       T01235                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
ant  Arcobacter nitrofigilis
Brite
Enzymes [BR:ant01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Arnit_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306356..307309
Genome map
AA seq 317 aa AA seqDB search
MSQDQQQLPRYSGIATFMRCAYEESLEGIDIGLIGVPFDGGVTNRTGTRHGPRDIRVQST
LMRSVNQSTGIAPFELCKVADVGDALPESPFELERSHKSIQSFFEKVVEAGVLPISAGGD
HSISLPILRALAKDEPVALVHFDAHCDTGGDYLGSKFHHGSPFRVAVEEGLIDPKKTIQI
GIRGSLNHKEMWKFSHDSGMRVIYMDEFYDLGVDGIIKEIHKIVGETPTYITFDVDGLDP
AFAVGTGTPEVGGFTTFEAIEMIRGLTGLHIVGGDVVEVSPPFDPSGSTALVGATMMFEL
LCIAAESLVARKDSLAC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagatcaacaacaattaccccgatatagtggtattgctacttttatgcgatgt
gcttatgaagagtcattagaaggaattgatattggattgattggtgtaccatttgatggt
ggtgtaactaaccgtactggtacacgtcatggtcctcgtgatatccgagttcagtcaact
ttaatgcgttcagtcaaccaaagtactggtattgcaccttttgaattatgtaaagttgct
gatgtaggtgatgcattaccagaaagcccatttgaactagaacgtagccataaatctatt
caaagtttttttgaaaaggttgttgaagcaggcgtgcttcccatttcagctggtggagac
cattcaataagtttacctattttaagagctttagctaaagatgagcctgtagcattagta
cacttcgatgctcattgtgatactggtggcgactatttaggatctaaattccatcatggt
tctccttttagagtagctgttgaagaaggcttaattgatcctaaaaaaactattcaaata
ggtattagaggttcacttaatcataaagaaatgtggaagtttagtcatgatagtggtatg
cgcgttatctatatggatgagttttatgacttaggtgttgatggaataattaaagaaatt
cataaaatagtgggagagacacctacttatatcacctttgatgttgacggtttagatcca
gcctttgcagttggaacaggtacgcccgaagttggtggttttactacctttgaagcaatt
gaaatgatccgtgggttaacaggtttgcatatagttggaggagatgtagttgaagtctca
cctccctttgatccctctggttcaacagcattagtaggcgcaaccatgatgttcgaatta
ctttgtattgctgctgagtcattagtagcgcgtaaagatagcttggcatgttag

DBGET integrated database retrieval system