KEGG   Arcobacter nitrofigilis: Arnit_0363Help
Entry
Arnit_0363        CDS       T01235                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ant  Arcobacter nitrofigilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Arnit_0363
   00052 Galactose metabolism
    Arnit_0363
   00500 Starch and sucrose metabolism
    Arnit_0363
   00520 Amino sugar and nucleotide sugar metabolism
    Arnit_0363
Enzymes [BR:ant01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Arnit_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
343524..344357
Genome map
AA seq 277 aa AA seqDB search
MKEKLIRKCLFPAAGYGTRFLPATKATPKEMLPILTKPLIQYGVEEAIAAGMDTMAIVTG
RGKRAIEDHFDISYELEHQIKGTSKEHYLTEIRSVIEKCTFSYTRQIEMKGLGHAILTGG
ETLIGNEPFAVILADDLCDHEGNGVLAQMVELYEKYKCSIVAIEEVPKDETYKYGVIEGK
EIEEGIFMISNMVEKPDPKDAPSNLAIIGRYILTPDIYEIIKNTKPGKNGELQITDSLMI
QAKENMVIGYKFKGKRFDCGSIDGFVEATNHFYNKAK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaacttattagaaagtgccttttcccagctgctggatatgggactagattt
ttacctgctacaaaagcaacacctaaagagatgttaccaatacttactaaaccacttatt
caatatggagtagaagaagcaattgctgctggcatggatactatggcaatagtaacagga
agaggtaaaagagctatcgaagatcattttgatatttcttatgagttagaacaccaaata
aaaggtacaagtaaagaacattatttaactgaaataagaagtgtaatagaaaaatgtacc
ttttcatatacacgacaaatagagatgaaaggtttaggtcatgctattttaacaggtggg
gaaactttaataggaaatgaaccttttgctgtaatacttgcagatgatttatgtgaccac
gaaggaaatggagttttagctcaaatggtagaactttatgaaaagtacaaatgctcaatc
gtagccattgaagaagtgccaaaagatgaaacatataaatatggagtaatagaaggtaaa
gagatagaagagggtatttttatgataagtaatatggtagaaaaaccagacccaaaagat
gctccatcaaaccttgcaattattggaagatatatcttaacacctgatatttatgagata
ataaaaaatacaaaaccaggtaaaaatggagaacttcaaataacagattctcttatgata
caagcaaaagagaatatggtaataggatacaagtttaaaggaaaaagatttgattgtgga
agtatagatggctttgtagaagctacaaaccatttttataataaagcgaaataa

DBGET integrated database retrieval system