KEGG   Arcobacter nitrofigilis: Arnit_0424Help
Entry
Arnit_0424        CDS       T01235                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arnit_0424
   01230 Biosynthesis of amino acids
    Arnit_0424
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arnit_0424
   00051 Fructose and mannose metabolism
    Arnit_0424
   00562 Inositol phosphate metabolism
    Arnit_0424
Enzymes [BR:ant01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arnit_0424
Exosome [BR:ant04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arnit_0424
  Exosomal proteins of bladder cancer cells
   Arnit_0424
  Exosomal proteins of melanoma cells
   Arnit_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409275..409979
Genome map
AA seq 234 aa AA seqDB search
MIIAANFKTNHTRASAKEYISFVNEYLTKEKDVEVIIFPTATALDNYETNPNLTIGTQNA
YSVNKGSFTGEIGTQQLDEFDIKTILIGHSERRHILGESQEEIAKKYAFYKELGYKIVYC
IGEPLEVKEQGLEQTLEYIYDQFVGIDTNYENLILAYEPVWAIGTGVTATTEDIKSVHSV
IKSKIDKPLLYGGSVKVENVAQICSLDGVDGALIGTASWVKEDFVQILENIKGL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattattgcagcaaacttcaaaacaaaccatacaagagctagtgcaaaagagtatatc
tcttttgtaaatgagtatttaactaaagaaaaagatgtggaagtaattatcttcccaaca
gctacagctttagataactatgaaacaaatcctaatttaactattgggacacaaaatgcc
tatagtgtaaacaaagggtcttttacaggtgaaataggaactcaacaacttgatgaattt
gatattaaaactattttaatagggcatagtgagagaagacatattttaggtgaatctcaa
gaagagattgcaaaaaaatatgctttttataaagaattaggatataaaatagtttattgt
attggggagcctttggaagtaaaagagcaaggtctagagcaaactttagagtatatttat
gatcagtttgttggaattgacacaaattatgaaaatcttattttagcctatgagccagtt
tgggcaataggaactggagttactgctacaactgaggatataaaatcagttcatagtgta
ataaaaagtaaaatagacaaaccacttctttatgggggaagtgtaaaagtagaaaatgtt
gcacaaatttgttcacttgatggagttgatggggcattaataggaacagcttcttgggtg
aaagaggattttgttcaaattttagaaaatataaaagggttataa

DBGET integrated database retrieval system