KEGG   Arcobacter nitrofigilis: Arnit_0424Help
Entry
Arnit_0424        CDS       T01235                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arnit_0424
   01230 Biosynthesis of amino acids
    Arnit_0424
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arnit_0424
   00051 Fructose and mannose metabolism
    Arnit_0424
   00562 Inositol phosphate metabolism
    Arnit_0424
Enzymes [BR:ant01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arnit_0424
Exosome [BR:ant04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arnit_0424
  Exosomal proteins of bladder cancer cells
   Arnit_0424
  Exosomal proteins of melanoma cells
   Arnit_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409275..409979
Genome map
AA seq 234 aa AA seqDB search
MIIAANFKTNHTRASAKEYISFVNEYLTKEKDVEVIIFPTATALDNYETNPNLTIGTQNA
YSVNKGSFTGEIGTQQLDEFDIKTILIGHSERRHILGESQEEIAKKYAFYKELGYKIVYC
IGEPLEVKEQGLEQTLEYIYDQFVGIDTNYENLILAYEPVWAIGTGVTATTEDIKSVHSV
IKSKIDKPLLYGGSVKVENVAQICSLDGVDGALIGTASWVKEDFVQILENIKGL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattattgcagcaaacttcaaaacaaaccatacaagagctagtgcaaaagagtatatc
tcttttgtaaatgagtatttaactaaagaaaaagatgtggaagtaattatcttcccaaca
gctacagctttagataactatgaaacaaatcctaatttaactattgggacacaaaatgcc
tatagtgtaaacaaagggtcttttacaggtgaaataggaactcaacaacttgatgaattt
gatattaaaactattttaatagggcatagtgagagaagacatattttaggtgaatctcaa
gaagagattgcaaaaaaatatgctttttataaagaattaggatataaaatagtttattgt
attggggagcctttggaagtaaaagagcaaggtctagagcaaactttagagtatatttat
gatcagtttgttggaattgacacaaattatgaaaatcttattttagcctatgagccagtt
tgggcaataggaactggagttactgctacaactgaggatataaaatcagttcatagtgta
ataaaaagtaaaatagacaaaccacttctttatgggggaagtgtaaaagtagaaaatgtt
gcacaaatttgttcacttgatggagttgatggggcattaataggaacagcttcttgggtg
aaagaggattttgttcaaattttagaaaatataaaagggttataa

DBGET integrated database retrieval system