KEGG   Arcobacter nitrofigilis: Arnit_0643Help
Entry
Arnit_0643        CDS       T01235                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ant  Arcobacter nitrofigilis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ant01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ant00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622897..624189
Genome map
AA seq 430 aa AA seqDB search
MKIINTTDSNFKEEFENILARAKTDIKGVSAIVTNIIDEIVEKGNGAIKEHILKFDKWEV
KQDSDLEISVEQMKKAYENIDEKLKKSLHIAYDRIKTYHEKQLPKSWIDFEKNGSILGQK
VSAVDRAGLYIPGGKAAYPSSLLMNAIPAIVAGVEEIVVCTPTPNDEINELLLAACHICG
IKKAFKVGGASAIAAMAYGTQTIPKVDVITGPGNIFVATAKKLVFGEVNIDMIAGPSEIG
ILSDASANPRFLAIDLLSQAEHDEMASSIMITTCDKVAELTSIEVDRFLETLSRREIAKK
SIDDRGAIIIASDMQEAIKLMNEIAPEHLEIMTNNAFELLPKIKHAGAIFLGKNTPEPIG
DYIAGPNHTLPTGSTAKFYSPLNVENFLKKSSIISFSQEAIDELGEACALLADTEGLTAH
AKSVRVRLEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataataaatactacagattcaaattttaaagaagagtttgaaaatattttagca
agagcaaaaacagatattaaaggtgtttctgcaatagttacaaatattattgatgagatt
gttgaaaagggaaatggtgccattaaagagcatattttaaaatttgacaaatgggaagta
aagcaagatagtgatttggaaatatcagttgagcagatgaaaaaagcttatgaaaatatt
gatgaaaaattaaaaaaatcacttcatatagcatatgacagaataaaaacttaccatgaa
aaacaacttccaaaatcttggattgattttgaaaaaaatggaagtatcttaggacaaaaa
gtaagtgcagttgatagagcaggactttatatccctggtggaaaagctgcttatccaagt
agcttacttatgaatgcaatcccagcaattgttgcaggtgttgaagagatagttgtatgt
actccaactccaaatgatgaaattaatgaacttcttcttgcagcatgtcatatctgtgga
atcaaaaaagcctttaaagtaggaggtgctagtgctattgctgctatggcttacggaacg
caaactattcctaaagtagatgttataactggacctggaaatatatttgttgcaactgct
aaaaagttagtttttggggaagtaaatattgatatgatagcaggtcctagtgagattgga
atcctaagtgatgcaagtgcaaaccctagatttttagctattgatttactttcacaagca
gaacatgatgaaatggcaagttctattatgataacaacatgtgataaagtagcagagctt
acttcaatagaagttgatagatttttagaaactttaagtagacgtgaaatagcaaaaaaa
tctattgatgataggggtgctataattattgcttcagatatgcaagaggctataaaactt
atgaatgaaatagcaccagaacatttagaaattatgacaaacaatgcctttgaactactt
ccaaaaatcaaacatgcaggagctattttcttaggtaaaaatacacctgaaccaataggt
gattatattgcaggtccaaatcatacacttcctactggaagtacagctaagttttatagt
ccattaaatgtggaaaactttttgaaaaaatcttcaataataagtttttcacaagaagcg
attgatgaacttggcgaagcttgtgccttacttgctgatactgaaggtttaacagcccat
gcaaaatctgtaagagtgagattagaaaaataa

DBGET integrated database retrieval system