KEGG   Arcobacter nitrofigilis: Arnit_0771Help
Entry
Arnit_0771        CDS       T01235                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ant  Arcobacter nitrofigilis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Arnit_0771
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Arnit_0771
Enzymes [BR:ant01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Arnit_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759804..761081
Genome map
AA seq 425 aa AA seqDB search
MQLHINNKIYTDNSKEADKNSAFVYSKQNEKFIEDAKKNGCKEFIKSEDLKNHCDFTSIK
VIGITGTNGKTTTAAAIYSLLLDLGYKVALQGTRGFFINEQRVEEYSLTTPVQLGNFAHI
QKAIENSCDFFVMEVSSHAIEQKRIEGLNFELKILTNITRDHLDYHKTIEEYINVKNSFF
NDDSKKLINKDEIKAKFNPKNCLTYGLDSPSTYKVQAYSFKDGMHVALQNFEKVESFTSM
MMGLFNVYNLTAAIAAVHMTTNKSLNEICEAVENFAGVSGRMETLSLNPYIIVDFAHTPD
GMKEVLQSFGHKDIIVVFGAGGDRDKAKRPIMGKVADTFAKHIIVTSDNPRFEDPDLIIE
DILEGINDKSKVEVEINRKIAIKKAIDLYSENSVILVLGKGDEEYQTIYDQKLPFSDKEV
INSYL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacttcacataaataataaaatatacacagataattctaaagaggcagataaaaat
tctgcctttgtttactcaaaacaaaatgaaaaattcatagaagatgctaaaaaaaatggt
tgtaaagagtttataaaatcagaagatttaaaaaatcattgtgattttacatctataaaa
gttattggaataactggaacaaatggaaaaactacaacagcagcagctatttattctctt
ttgttagatttaggatataaagttgcacttcaaggtacaagaggattttttatcaatgaa
caaagagtagaagagtactctttaactactcctgtgcaacttggaaattttgcacatata
caaaaagctatagaaaattcttgtgatttttttgtgatggaagttagttcccatgcaatt
gaacaaaaaagaatagagggtttaaactttgaacttaaaattcttacaaatattacaagg
gatcatcttgattatcataaaactattgaagagtatataaatgttaagaactcttttttt
aatgatgatagtaaaaaacttataaataaagatgaaataaaagcaaaatttaaccctaaa
aattgtttaacttatggtcttgattctccaagtacttataaagttcaagcatattcattt
aaggatgggatgcatgttgctttacaaaattttgaaaaagtagagagttttacttctatg
atgatgggactgtttaatgtatataatttaacagctgcaatagctgctgttcatatgact
acaaataagtcattaaatgaaatttgtgaagctgtagaaaattttgctggcgtttctgga
agaatggaaacccttagtttaaatccatatattattgttgattttgcccacactccagat
ggtatgaaagaggttttacaaagctttggacataaagatattattgttgtgtttggagca
ggtggagatagggataaggctaaacggccaattatgggaaaagtagcagatacttttgct
aaacacattattgtaacaagtgataatccaagatttgaagatcctgatttgattatagaa
gatatcttagaaggtattaatgataaatcaaaagtagaagtggagataaatagaaaaatt
gcaataaaaaaagctattgatttgtatagtgaaaatagtgtgattttagttttaggaaaa
ggtgatgaagagtatcaaactatttatgaccaaaagcttcctttctctgataaagaggtt
ataaactcttatctataa

DBGET integrated database retrieval system