KEGG   Arcobacter nitrofigilis: Arnit_0783Help
Entry
Arnit_0783        CDS       T01235                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00230  Purine metabolism
ant01100  Metabolic pathways
Module
ant_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Arnit_0783
Enzymes [BR:ant01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Arnit_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin Rad17 ABC_tran AAA_16 AAA_18 AAA_33 AAA_22 AAA ATPase_2 AAA_14 RNA_helicase NB-ARC RRF AAA_23 RsgA_GTPase AAA_29 Viral_helicase1 NACHT NTPase_1 MMR_HSR1 AAA_17 Adeno_IVa2 Sp38 T2SSE Cytidylate_kin PfkB AAA_5 cobW AAA_28 AAA_30 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ADG92447
UniProt: D5V2L5
Position
771255..771872
Genome map
AA seq 205 aa AA seqDB search
MVNDKKGAILIISGPSGCGKSTLLKEVYKDIDDYYFSISSTTRAPRVGEKDGVDYFFISK
EEFLKDIEAGYFLEWAEVHGNYYGTSLKPIEKAVSEGKLAIFDIDVQGHDIAREKLNDLI
TSVFITTPTLSELENRLNKRATDSKEIIENRIKNAKDEIKHFHKYDYFIVNDDLEKASKQ
LVSIANITRIKSKLFDPKLPESWLD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaatgataaaaaaggtgcgatattaattatatcaggacctagcggttgtggaaaa
tcaactttattaaaagaagtatataaagatattgatgattattatttctctatttcttca
actacaagagctccaagagttggagaaaaagatggagttgattacttctttattagtaaa
gaagagtttttaaaagatattgaagctggttattttttagagtgggcagaagttcatgga
aactattatggaacatctttaaagccaattgaaaaagctgtgagtgaaggtaaacttgct
atttttgatattgatgtacaaggtcatgatatagctagagaaaaattaaatgatttaatt
acttctgtttttattacaacaccaactttgagtgaactagaaaataggttgaataaaaga
gcaactgatagtaaagagattattgaaaatagaataaaaaatgcaaaagatgagataaaa
cattttcataagtatgattattttatagtaaatgatgatttagaaaaagctagtaagcag
ttagtaagtattgcaaatattactagaatcaaaagtaaactttttgatcctaaattacct
gagagttggttagactaa

DBGET integrated database retrieval system