KEGG   Arcobacter nitrofigilis: Arnit_0878Help
Entry
Arnit_0878        CDS       T01235                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Arnit_0878
Enzymes [BR:ant01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Arnit_0878
Exosome [BR:ant04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arnit_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874380..875900)
Genome map
AA seq 506 aa AA seqDB search
MKYILSIDQGTTSSRAILFNKEMKIEKISQEEFPQYFPHSGWVEHNPEDLFNTVLNSCKN
VLKEANAKIEDIVSIGITNQRETTVVWDKHTGEAVYNAIVWQDRRTSKECDVFKKAGHEK
MIREKTGLLFDPYFSAMKLKWILENVDGAKEKALNGDLLFGTVDTFLIWKLSNKKSHVTD
ATNAARTMLYNINANEWDKEICTLLDIPMDMLPEVKDCADDFANVDKEHLGREIPINGVA
GDQQSALIGQACFEPGMVKSTYGTGCFAILNIGSNMILSKNRLLTTIAYRFNGQTTYALE
GSIFIAGAVVQWLRDGLKIIKNAKEAQELALKADPTEQLYFVPAFTGLAAPYWDTHCRGA
IYGLTRNTGPEDFAKAALESVAYQTKDLLEAMYSDWNNFGECIDYAKNSVLRIDGGMSAS
DYTIQFLSDMLGTSVDRPEILETTALGVAWLAGMKAGFYPSKDEFSKAWKLEKKFKPTIS
EEKRYDLYAGWKDAVQRTLSKKSNQI
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatactatcaatagatcaaggtacaacttcaagtagagcaattttatttaac
aaagagatgaaaattgagaaaatatctcaagaagagttccctcaatattttcctcattct
ggttgggtagaacacaatcctgaagatttatttaatacagttcttaatagttgtaaaaat
gtattaaaagaagcaaatgcaaagattgaagatattgtatctattggaataactaatcaa
agagagacaactgttgtatgggataaacatacaggagaagcagtttataatgcaattgta
tggcaagatagaagaacatcaaaagagtgtgacgtctttaaaaaagcaggacatgaaaag
atgattcgagaaaagactggtttactatttgatccttatttttcagctatgaaattaaaa
tggattttagaaaatgtagatggtgctaaagaaaaagctcttaatggagatttattattt
ggaacagttgatacttttttaatctggaaattaagtaataaaaaaagccatgtaactgat
gctacaaatgccgcaagaacaatgctatataatataaatgcaaatgaatgggacaaagaa
atttgtactcttttagatattccaatggatatgttacccgaagttaaagattgtgcagat
gattttgcaaatgttgataaagaacatctaggaagagaaattccaataaatggtgttgca
ggagatcaacaatctgcacttataggacaagcttgttttgaacctggaatggttaaatct
acttatggaactggttgctttgctattttaaatatcggttcaaatatgattttatcaaag
aatagactacttacaaccatcgcttatagatttaatgggcaaacaacttatgccttagaa
ggttcaatttttattgcaggtgctgttgttcaatggttaagggatggtttaaaaatcata
aaaaatgcaaaagaggctcaagaattagctttaaaagctgatccaaccgaacaactctat
tttgtacctgcatttacaggacttgccgcaccctattgggatacccattgtagaggtgct
atttatggtcttacaagaaacactggaccagaagattttgcaaaagcagctttagaaagc
gtagcttatcaaacaaaagatttattagaagctatgtatagtgattggaataattttgga
gaatgtattgattatgctaaaaactctgttttaagaatagatggtggaatgtcagcttca
gattatactattcaatttttatctgacatgttaggaacttcagttgacagacctgaaata
cttgaaacaactgcattaggtgttgcttggcttgcaggtatgaaagcaggattttatcct
tcaaaagatgagttttcaaaggcttggaagttggagaaaaaatttaaacctactattagt
gaagaaaaaagatatgatctttatgcaggttggaaagacgctgtacaaagaacactttca
aaaaaatctaatcaaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system