KEGG   Arcobacter nitrofigilis: Arnit_0933Help
Entry
Arnit_0933        CDS       T01235                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ant  Arcobacter nitrofigilis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Arnit_0933
Enzymes [BR:ant01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Arnit_0933
Transfer RNA biogenesis [BR:ant03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Arnit_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929647..930396
Genome map
AA seq 249 aa AA seqDB search
MLEKINLNDIKDIALKAGLVIMEIYNKDFEVEYKEDNSPLTQADIKSNEIICNSLINLYP
NIPIMSEENKQTNYEQRKDWEYYWCIDPIDGTKEFIKKNGEFTVNIALIHNQEPVLGVVY
APAIDVMYSAKKGVGAFKNIHKLPIKRDDNKYIIVASKSHMSEETQTYIDNIETTKEKEM
ISMGSSLKLCLVADGSADCYPRVAPTMEWDTAAADAIVRCAGKMSYHLELEKPLIYNKKD
LLNPNFVVK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgttagaaaagataaatctaaatgatataaaagatattgcactaaaagctggtcttgta
ataatggaaatttataataaagattttgaagtggagtataaagaagacaactctccactt
acccaagctgatataaaatcaaatgaaatcatttgcaatagtttgataaatctatatccc
aatattccaattatgtctgaagagaataaacaaacaaattatgaacaaagaaaagattgg
gagtattattggtgtattgatccaatagatggaacaaaagaatttatcaaaaaaaatggg
gagtttactgtaaatattgctttaatacataatcaagaaccagttttaggagtagtttat
gctcctgcaattgatgttatgtatagtgcaaaaaaaggtgtaggtgcttttaaaaatata
cataaacttccaataaaaagagatgataataaatatattattgttgctagtaaatcacat
atgtcagaagaaacacaaacatatattgataacatagaaacaacaaaagaaaaagagatg
atttctatgggaagttcactaaaactttgtttagtagcagatggtagtgctgattgttat
ccaagagttgctcctactatggaatgggatacagcagcagcagatgcaatagttagatgt
gcaggaaagatgagttatcatttagaattagaaaaaccacttatttataacaaaaaagat
ttattgaatccaaattttgtggttaaataa

DBGET integrated database retrieval system