KEGG   Arcobacter nitrofigilis: Arnit_0942Help
Entry
Arnit_0942        CDS       T01235                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arnit_0942
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arnit_0942
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arnit_0942
Enzymes [BR:ant01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arnit_0942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
936599..937810
Genome map
AA seq 403 aa AA seqDB search
MQEIYIPKKSNFDPDENGHFGKFGGRYVPETLMPILLELEAEYKKYRFDKEFWGEVNELL
REYVGRENPLYHAKNISEEIGAKVYLKREDLNHTGAHKINNVIAQGLLAKKLGKTKVIAE
TGAGQHGVASATIAALLGLECTVFMGAKDVERQELNVFRMKLLGAKVVAVQSGSKTLKDA
MNDAIRYWVTNARDTFYIIGTVAGPHPYPMMVRDFQAVIGWEARRQALQKDGRLPDYVLA
CIGGGSNAIGIFSHFLEDKEVTCIGIEAGGLGTSTDKHGCSLEKGSPGILHGQCSYLLQD
EDGQVLEAHSFSAGLDYPGIGPEHSFHKDNKTVQYDSITDEEALDAFVWLSRREGIIPAF
ESAHAIAYLKKAKEKFQGKTVIVNLSGRGDKDMVQAKDLLNFE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatatatatacctaaaaaaagtaattttgatccagatgaaaatggtcatttt
ggtaaatttggtggaagatatgttcctgaaacattgatgccaattctacttgaactagaa
gctgaatacaaaaaatatagatttgacaaagaattttggggcgaagtaaatgaactatta
agagagtatgtgggaagagaaaatcctttatatcatgcaaaaaatatctctgaagaaatt
ggtgcaaaagtttatctaaaaagagaagatttaaaccatacaggtgcccataagataaac
aatgtaattgcacaaggattattggctaaaaaacttgggaaaacaaaagttatagctgaa
actggtgctggacaacatggagttgcaagtgcaactattgctgcacttttaggcttagag
tgtacagtatttatgggtgcaaaagatgtagaaagacaagaacttaatgtatttagaatg
aaacttctaggtgctaaagttgtagccgttcaatctggaagtaaaactttaaaagatgct
atgaatgatgcgattagatattgggtaacaaatgcaagagatactttttatataattgga
actgttgctgggcctcatccatatcctatgatggtaagagattttcaagcagttattggt
tgggaagcaagacgacaagctttacaaaaagatggaagattacctgattatgtattagct
tgtattggtggaggatcaaatgctattggtattttttcacactttttagaagataaagaa
gtaacttgtataggaatagaagcaggagggcttggaacaagcacagataaacatggttgt
tctttagaaaaaggaagtcctggaatattacatggacaatgttcttacttacttcaagat
gaagatggacaagttttagaagcacactcattttcagcaggtcttgattacccaggaatt
ggaccagaacactcttttcacaaagataataaaactgtgcaatatgattctattacagat
gaagaagcacttgatgcttttgtatggttaagtagaagagaaggaattattcctgctttt
gaaagtgctcatgcaatagcatacttaaaaaaagcaaaagaaaaatttcaagggaaaaca
gtaattgtgaatttatctggtcgaggtgataaagatatggttcaagcaaaagatttatta
aattttgaatag

DBGET integrated database retrieval system