KEGG   Arcobacter nitrofigilis: Arnit_1082Help
Entry
Arnit_1082        CDS       T01235                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ant  Arcobacter nitrofigilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ant00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Arnit_1082
Enzymes [BR:ant01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Arnit_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067093..1067653
Genome map
AA seq 186 aa AA seqDB search
MIVGINGKIIRKEPTLLHIDVNGLVYEVFVSVNCSSKIIENNVSLHTTYIIREDSQALYG
FIDVNEKKLFDTVIKINGVGPKVALAICSTFTPSSFSQIVSSNDISMLKRVPGIGPKGAS
RILVELSGFVIDGNSDEDSVGTNMMEASMALESLGFKKDVISKALKSCSATNTSDLVREA
LKKLQK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatagttggaataaacggaaaaataataagaaaagaaccgactctattacatattgat
gttaatggactagtttacgaagtctttgtatctgttaattgtagttctaaaataatagaa
aataatgtttcattgcatactacatacataataagagaagactctcaggctttgtatggc
tttatcgatgtaaatgaaaaaaaactttttgatacagtgataaaaataaatggtgtagga
cctaaagtagcccttgctatttgttcaacctttactccaagttctttttctcaaatagta
agttcaaatgatatctcaatgttaaaaagagttccaggcattggtccaaaaggtgctagt
agaattttggttgaattatctggatttgttattgatggaaatagtgatgaagattcagtt
ggaacaaatatgatggaagcatctatggcattggaatcattaggattcaaaaaagatgtt
ataagtaaagcattaaaaagctgtagtgctacaaatacaagtgacttggtaagagaagca
cttaaaaaattacaaaaatag

DBGET integrated database retrieval system