KEGG   Arcobacter nitrofigilis: Arnit_1347Help
Entry
Arnit_1347        CDS       T01235                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00071  Fatty acid degradation
ant00280  Valine, leucine and isoleucine degradation
ant00281  Geraniol degradation
ant00310  Lysine degradation
ant00362  Benzoate degradation
ant00380  Tryptophan metabolism
ant00410  beta-Alanine metabolism
ant00640  Propanoate metabolism
ant00650  Butanoate metabolism
ant00903  Limonene and pinene degradation
ant00930  Caprolactam degradation
ant01040  Biosynthesis of unsaturated fatty acids
ant01100  Metabolic pathways
ant01110  Biosynthesis of secondary metabolites
ant01120  Microbial metabolism in diverse environments
ant01130  Biosynthesis of antibiotics
ant01200  Carbon metabolism
ant01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Arnit_1347
   00650 Butanoate metabolism
    Arnit_1347
  Lipid metabolism
   00071 Fatty acid degradation
    Arnit_1347
   01040 Biosynthesis of unsaturated fatty acids
    Arnit_1347
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arnit_1347
   00310 Lysine degradation
    Arnit_1347
   00380 Tryptophan metabolism
    Arnit_1347
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arnit_1347
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arnit_1347
   00281 Geraniol degradation
    Arnit_1347
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arnit_1347
   00930 Caprolactam degradation
    Arnit_1347
Enzymes [BR:ant01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Arnit_1347
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Arnit_1347
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Arnit_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG93005
UniProt: D5V570
Position
complement(1314755..1316875)
Genome map
AA seq 706 aa AA seqDB search
MNNLNLEINNDIATLTFDLKNTKANKLSFEVLSELNNALDEIKQNKQIKVLVIDSAKPTI
FIAGADIKEIEAMSTEEEVYEQITKGDNILTKLEALSIPTIAYINGACMGGGLELALCCK
YRVATTNEKTKLAFPEIKLGFFPGLGGTQRAPKLVGLITALEMILTGKNHDAKKALKMGL
VDEIFDNGQKEFKLKEFITKVLENKVQRKKLPFVNNLMEKFSFTRAYIYKKSLQGIEKKV
NRDFKAPYTALEVIQNTFTESFEKGIDIEARAFSQLAATKESKYMIELFFMFEKLNKNFE
KTPTPISNVAVLGNGVMGKGIIWLFSKFLNEIRIKIRKIEQANDIIKDVAKLYDSSIKRR
TMSQNQVDFKLNKISYTDKFNGLGQTQLALEAIIENENAKKEAFKELEEVLDKDAIIATN
TSSISIEKLGSELKNKKNFLGIHFFNPVNMMPLVEVIPSSHTSKKTINRVIELLTTCGKT
PIVVGDCAGFIVNRILLPYINEAAFILEEGSDIKTIDKILKDFGLPMGPFILADTVGIDI
GFKVATILQESYGSRMTVAPILTKVYKDLKLLGKKAKKGFYLHNTKNLEINEEVTKLLST
NRKEFTQKEIIERCMFIMVNEASRCLEEGIVNDPKIIDFAMITGTGFPPYKGGICAYAND
MGISYIVDELKQYEKVFGERFKPSLLLEKLDKENKDFKTGEELWKL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttaaatttagaaataaataatgatattgcaacattaacctttgatttaaaa
aacacaaaggcaaataaattatcttttgaagtattaagtgaactaaacaatgccttagat
gagataaaacaaaataagcaaataaaagttcttgttattgatagtgcaaaacctactata
tttattgcaggtgctgatattaaagagatagaggctatgagcacagaagaagaagtttat
gagcaaatcacaaaaggtgataatatcttaactaaactagaagccttaagtataccaaca
atagcctatatcaatggagcttgtatgggtggaggtttagaacttgctttatgttgtaaa
tatagagttgctactacaaatgaaaaaacaaaattagcctttcctgagataaaacttgga
tttttcccaggtcttgggggaacacaaagagccccaaaacttgtagggcttataactgcc
cttgagatgattttaacgggtaaaaatcatgatgctaaaaaagcattaaaaatgggactt
gtggatgaaatatttgataatggacaaaaagagtttaagttaaaagagtttattacaaaa
gttcttgaaaacaaagttcaaagaaaaaaactaccttttgtaaataatcttatggaaaaa
ttttctttcacaagagcatacatttacaaaaaatcattacaaggaatagagaaaaaagta
aatagagattttaaagcaccgtatacggctttggaagttatacaaaatacttttactgaa
agctttgaaaaaggtatagatatagaagctagagctttttcacaactagcagcaacaaaa
gagtctaagtatatgatagagctatttttcatgtttgaaaaactaaataaaaatttcgaa
aaaacaccaactccaatttcaaatgtagcagtattaggaaatggtgtaatgggtaaagga
attatttggttattttcaaagtttttaaatgaaataagaatcaaaataagaaaaatagaa
caagccaatgacatcataaaagacgttgcaaaactatatgatagttctataaaaagaaga
actatgagtcaaaatcaagttgactttaaattaaataaaatctcttatactgataaattt
aatggtttaggtcaaacccaactagctctagaagctattattgaaaatgaaaatgcaaaa
aaagaggcttttaaagaactagaagaagttcttgataaagatgcaattattgcaacaaat
acttcttcaatctccatagaaaaacttggaagtgaactaaaaaataagaaaaactttttg
ggaatacattttttcaatcctgtaaatatgatgccacttgttgaagttataccttcatca
cacacttctaaaaagactataaatagagtaatagagttattaacaacttgtgggaaaaca
cccatagtagttggagattgtgctggatttattgtcaatcgtattttacttccatatata
aatgaggctgcttttatactagaagagggttcagatattaaaaccatagataaaatttta
aaagattttggtttacctatgggaccttttattttagcagatactgttggtattgatata
ggttttaaagtagcaacaatattacaagaatcatatggttcacgtatgactgtagctcct
atacttacaaaagtatataaagacttaaaattattaggtaaaaaagccaaaaaaggtttt
tatcttcataacacaaaaaatttagagataaatgaagaagttacaaaactactttcaaca
aatagaaaagaatttacccaaaaagagataattgagcgttgtatgtttattatggtaaat
gaagcctcaagatgtttggaagaaggtattgtaaatgatccaaaaatcatagattttgct
atgattacaggtactggttttcctccatataaaggtgggatttgtgcctatgcaaatgac
atgggaatttcatatattgtagatgaactaaaacaatatgaaaaagtttttggcgaaaga
tttaaaccaagtttattattagaaaaattagataaagagaataaagattttaaaacaggg
gaagaattatggaagctttag

DBGET integrated database retrieval system