KEGG   Arcobacter nitrofigilis: Arnit_1558Help
Entry
Arnit_1558        CDS       T01235                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ant  Arcobacter nitrofigilis
Brite
Enzymes [BR:ant01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Arnit_1558
Secretion system [BR:ant02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Arnit_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1557539..1558270
Genome map
AA seq 243 aa AA seqDB search
MKKIFKLMFLFSMLISLNAFASTELSKSEVNEIGKLPIFFGSGMKVLKAYKEDNFYLLRV
NIQENIQELVLTADKKYLIAGKIYNVLSGEQVSIPNDVSILKDKEVLTYGTGNDVYYLFT
DPECPYCKKFESYFDQIKNDVQFKIYLFPLSFHKNAIPLSKYILSFKSNEDRVNALLNVT
PSTKEFLDKKFTKAQDEALTNVINAQMKLGEKLGVRGTPTLYDIHGKALSWVKVLERYGV
EVK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttttaaattgatgtttttatttagtatgctaatttcattgaatgctttt
gcatcaacagaattaagtaaaagtgaggttaatgaaatagggaagcttccaatatttttt
ggttctggaatgaaagttttaaaggcttataaagaagataatttttatttactaagagta
aatattcaagaaaatattcaagaattagttttaactgctgataaaaaatatttaattgca
ggtaaaatttataatgttctatctggtgaacaagtttcaattcctaatgatgtatcaatt
ttaaaagataaagaagttttaacttatggtacaggaaatgatgtatattatttatttaca
gatccggagtgcccttattgtaaaaaatttgagtcatactttgatcaaattaaaaatgat
gttcaattcaaaatttatcttttccctttgagttttcacaaaaatgcaatacctttatct
aagtatattttatcatttaaatcaaatgaagatagagtaaatgcactattgaatgtaact
cctagtacaaaagagtttttagataaaaaatttactaaagcacaagacgaagctttaaca
aatgttattaatgctcaaatgaaattgggtgaaaaactaggtgtaagaggaactccaaca
ttatatgatatacatggaaaagcactttcatgggtaaaagtcttagaaagatatggggta
gaagttaaataa

DBGET integrated database retrieval system