KEGG   Arcobacter nitrofigilis: Arnit_1633Help
Entry
Arnit_1633        CDS       T01235                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arnit_1633
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arnit_1633
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arnit_1633
Enzymes [BR:ant01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arnit_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1641853..1643067)
Genome map
AA seq 404 aa AA seqDB search
MKDSYLSSYPDEKGYFGRFGGSYIPEQLIKPFEEITKAYNEIKNSEEFIKELKYVRRHYQ
GRPTPVSYAKNLTQFCGGAKIYLKREDLNHTGAHKLNHCMAEVILAKHLGKKKVIAETGA
GQHGVALATAAAYFGLECEIHMGEVDIKKEHPNVLRMKILGAKVVPVSHGLKTLKEAVDS
AFQAYLSDTENSIYCIGSVVGPHPFPMMVRDFQSIIGFEAREQFWGHENKLPNYVIACVG
GGSNAMGIFSGFIDDEGVNLYGVEPLGRGENLGEHAASLTYGSEGIMHGFNSIMLKDKNG
EPAPVYSIGSGIDYPSVGPEHAFLMDSGRTKVGLCDDKEAVNAFYKLSQLEGIIPALESA
HAVAYAMKLAPSLSKDETILVNLSGRGDKDIDFVIENYPLSDFQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcatatttaagttcatatcctgatgaaaaaggatattttggtagatttggt
ggttcttatattcctgaacaactaataaaaccatttgaagaaattactaaagcatataat
gaaattaaaaactcagaagaatttataaaagagttgaaatatgtaagaagacattatcaa
ggaagacctactcctgtctcatatgctaaaaatttaacacaattttgtggtggtgcaaaa
atatatttaaaaagagaagacttaaaccacacaggagcccataaattaaatcattgtatg
gctgaagtaatattagctaagcatttaggtaagaaaaaagttatagcagaaacaggagcg
ggacaacatggtgttgcccttgcaacagcagctgcatattttggattagagtgtgagatt
catatgggtgaagttgatataaaaaaagaacacccaaatgtacttagaatgaagatactt
ggtgcaaaagtagtaccggtatcacatggcttaaaaactctaaaagaagcagtagattca
gcttttcaagcatatttatcagatacagaaaactctatttattgtataggctcagttgta
gggcctcacccttttcctatgatggttagagatttccaaagcataattggatttgaagct
agagaacaattctggggtcatgaaaataaacttcctaattacgtaattgcctgtgttggt
ggtggttcaaatgccatgggaatattctctggttttattgatgatgaaggtgttaattta
tatggagttgaacctttaggtagaggtgaaaatttaggagaacatgcagctagtttaaca
tatggaagtgaaggaattatgcatggatttaattctattatgttaaaagataaaaatggg
gaaccagcacctgtttattctataggaagtggaattgattatccatcagttggaccagaa
catgcatttttaatggatagtggaagaacaaaagttggattatgtgatgataaagaagct
gtaaatgctttttataaattatctcaacttgaaggaataattccagcattagaatctgcc
catgcagttgcatatgctatgaaattagcacctagtttaagtaaagatgagacaatattg
gtcaacttaagtggtagaggtgacaaagatatagattttgttattgagaactaccctctt
tctgattttcaataa

DBGET integrated database retrieval system