KEGG   Arcobacter nitrofigilis: Arnit_1636Help
Entry
Arnit_1636        CDS       T01235                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ant  Arcobacter nitrofigilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ant00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Arnit_1636
DNA repair and recombination proteins [BR:ant03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Arnit_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1647079..1647651
Genome map
AA seq 190 aa AA seqDB search
MKLGLNKFYDLVEAFENLPTIGKKSAQRLAYHIIMNDNYCGIKIAHSIENALKSIRKCSK
CGCMSEHEICEICLDDERESSFICVVQSAKDIFTIEESKQFNGKYFVISHLDEIVLDQFI
TYIKTNKVKDILFAISPSLSNDAFILFIEDKLKEFDINFTKIAQGVPTGVSLENVDILSL
AKAIQSKVLI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttggattaaataaattttacgacttagtagaagcatttgaaaacttgccaaca
ataggtaaaaaatcagcacaaagacttgcttatcatattattatgaatgataattattgt
gggattaaaattgcacatagtattgaaaatgctttaaaatcaataagaaaatgttcaaaa
tgtggctgcatgagtgaacatgagatttgtgaaatttgtttagatgatgaaagggagtct
agttttatttgtgttgttcaatctgcaaaagacatttttacgattgaagagtcaaaacag
tttaatggaaaatattttgtaatatctcacttagatgaaatagtattagaccaatttatt
acatatattaaaacaaataaagtcaaagatattctttttgcaatatctccttcattatcc
aatgatgcttttattttatttattgaagataaactaaaagaatttgatataaattttaca
aaaatagcgcaaggtgtcccaacaggggttagtttagagaatgttgatattttgtccttg
gcaaaagcaattcaaagtaaagtgttgatttaa

DBGET integrated database retrieval system