KEGG   Arcobacter nitrofigilis: Arnit_1697Help
Entry
Arnit_1697        CDS       T01235                                 

Definition
family 24 glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ant  Arcobacter nitrofigilis
Brite
Enzymes [BR:ant01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Arnit_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697169..1697585
Genome map
AA seq 138 aa AA seqDB search
MLMDRTERMLIKHEGLQTKVYTCPANKLTIGVGRNLEDRGITKKEALYLLNNDIVECHNK
LSLELPFYDSLDDVRQEVLINMCFQLGFTGFSKFKKTLKYINDFDFEKASKEMLNSLWAK
QTPNRANELAQILRKGEY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgttaatggatagaactgaaagaatgttaattaaacatgagggattacaaactaaggtt
tatacttgccctgcaaataaattaactattggtgtaggtaggaatttagaagatagaggt
atcacaaaaaaagaagctttatatcttttgaataacgacatagttgaatgtcataataaa
ttatctttagaattacctttttatgattctttagatgatgttaggcaagaagtgttaata
aatatgtgttttcaattaggttttacgggattttcaaaatttaaaaagactttgaaatat
attaatgattttgattttgaaaaagcttcaaaagaaatgcttaattctttatgggcaaaa
caaactccaaatagagcaaatgaattagcacaaatcttaagaaagggggaatattaa

DBGET integrated database retrieval system