KEGG   Arcobacter nitrofigilis: Arnit_1906Help
Entry
Arnit_1906        CDS       T01235                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ant  Arcobacter nitrofigilis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ant00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1902585..1903160
Genome map
AA seq 191 aa AA seqDB search
MIDQNHVDQLSKLSLTLFRKNFFGIYHGSISTKLDHNTFMINTSDAIFDEMNEKSFCELS
MTSQDYRWKLASIEAHIHATIYNNIHEAKYIAFGVPIYTTAYTFEHDEIVLDDFFGKTSF
EKIKIFDPGDFSTWYDRNALEITKYLKDTNNHVMVIKGIGAYVYDRDINELVKKVAILEN
SCRLLSIKSSF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcaaaatcatgtagaccaactaagtaaactatctttgacactttttagaaaa
aacttttttggtatatatcacggttctatttctacaaaattagatcataatacatttatg
ataaacacttcagatgcaatctttgatgaaatgaacgaaaaatcattttgtgaattaagc
atgacaagtcaagattatagatggaaactagcaagtatagaggcacatatacatgcaact
atatataataatatacatgaagcaaaatatattgcctttggggttcctatttatacaact
gcttatacttttgaacatgatgagatagttttggatgatttttttggaaaaacatctttt
gaaaaaataaaaatatttgaccctggagatttttcaacttggtatgatagaaatgcactt
gaaataacaaaatatctaaaagatacaaataatcatgttatggttataaaaggaattggt
gcttatgtatacgatagagatataaatgaactagtaaaaaaagttgcaattcttgaaaat
agttgtagattattgagtataaaatctagtttttaa

DBGET integrated database retrieval system