KEGG   Arcobacter nitrofigilis: Arnit_1934Help
Entry
Arnit_1934        CDS       T01235                                 

Definition
AAA ATPase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ant  Arcobacter nitrofigilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ant00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Arnit_1934
Enzymes [BR:ant01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Arnit_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1930240..1932522)
Genome map
AA seq 760 aa AA seqDB search
MQDENKSFKLSGILKKVLFSNRDTGFCIAVLDNDQKICGTYFDTDIEKIVGENIVLTGNW
VTHKKYGIQFAFDTLELKEQELYFFLTKIVKGIGRKVALELLEKYTEEELVTVLNDKPEE
LLNFKGIREKKLTTIKTSWQKFKHLRELGSFLSKFGVTSNLITKIYSEFSEVENLIEVIK
ENPYVLIRIKGIGFKRADEIAKALGIDERSDFRIMACLNYTLREYCDNNGNSSIDKYHLF
RLLDEALRFQNEEMLYENAIAKMELDEDIYKTKENRYAPSMLYFAEKRVLEFFKARENDM
YLKKIVSNITEYLDKKEKTLGFTLSPEQRKAVELINEGHKTLFLIGYAGTGKSTSSRAIL
ELLQEINSYDDIIAIALSGIASQRIADTTGYNSSTIQSLFVKHKENEHFPYKVILLDEAS
MVNSVMFYQIISKIGQDTIFIIVGDDGQLPAIGAGNILSDSIKYELAPICKLTKIYRQNE
NQAIAVIANEIRQGNVPEYNGDYEDFKFMDVSISNYYASKNSLGQNEFSNLRGQNSEMIL
SMILNISSAYIKEFYKLIKGKDISKALILFQIITPMKGGMLGAENLNIQLQKIFNSSREE
SKQTKLYEYKLSDKVIHIKNENMRAQTMQMYRTGSTEYLERRVFNGQLGLIIKLDFEESK
CIVLYPNDDMVVFYDFDDLDSLLSLAYCLTIHKTQGMEYDNALIPMSFSHYIMHNTKLLY
TAITRAKSMCYIVGEEDAFKGACKRIETTKRESVINDLLS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgagaataaaagttttaaactttcaggaatattaaaaaaagtactattttcg
aacagagatacgggattttgtattgcagtattggataatgatcaaaagatatgtggaaca
tattttgatactgatattgaaaaaattgtgggtgaaaatatagttttaacaggtaattgg
gtaactcataaaaaatatggaatacaatttgcttttgatactttagagttaaaagaacag
gagctttatttctttttgacaaaaatagttaaaggaatagggcgaaaagtagctttagaa
ttactagaaaaatatactgaagaagagttggttactgttttaaatgacaagccagaagag
cttttaaacttcaaaggaataagagaaaaaaaactaacaactataaagacttcatggcaa
aagtttaaacacttaagggaacttggttcttttttatcaaagtttggagttacttcaaat
cttattacaaagatttattcagagtttagtgaagtagaaaatctaattgaagtgataaaa
gaaaatccatatgtattgattcgtataaaaggtataggatttaaaagagctgatgaaata
gcaaaagccttaggaatagatgaaaggtcagattttaggattatggcttgtttgaactat
actttaagagagtattgtgataataatggaaactcttcaatagataaatatcatcttttt
agactattagatgaagccttaagattccaaaatgaagagatgttatatgaaaatgcaata
gcaaaaatggaacttgatgaagatatttataaaacaaaagagaatagatatgctccttca
atgttgtattttgcagaaaaaagagttttagagttttttaaagctagagaaaatgatatg
tatttgaaaaaaatagtttcaaatataactgaatatttagataaaaaagagaaaacttta
ggtttcactttaagtcctgaacaaagaaaagcagtagaacttataaatgaaggtcataaa
acactgtttttaataggttatgcaggaacagggaaatcaacatcaagtagagcaattctt
gaacttcttcaagagataaactcttatgatgatattattgctattgctttaagtggtatc
gcctctcaaagaattgcagatactacaggttataatagctcaactatacaatcccttttt
gtaaaacataaagagaatgaacactttccatataaagtaatattacttgatgaagcttca
atggtaaattctgttatgttttatcaaataatatcaaaaatcggtcaagatactattttt
ataatagtgggtgatgatgggcagttaccagctattggtgctggaaatatattaagtgat
tctataaaatatgaactagcacctatttgtaaacttacaaaaatatatagacaaaatgaa
aatcaagcaatagctgtaatagcaaatgaaataagacaaggaaatgtgcccgaatacaat
ggtgattatgaagattttaaatttatggatgtttctatatcaaattattatgcttctaaa
aactctttaggacaaaatgaattctcaaatttaagaggccaaaattctgagatgatatta
agtatgatattaaatatatcaagtgcttatattaaagaattttacaaattaattaagggc
aaagatatatcaaaagctcttattctttttcaaataattactcctatgaaaggcggtatg
ttaggtgctgagaatctaaatatccaattgcaaaaaatatttaatagttcaagggaagag
tcaaaacaaactaaactttatgaatataaactaagtgataaagtaattcatataaaaaat
gaaaatatgagagcccaaactatgcaaatgtacagaacaggttcaactgaatatttggaa
agaagagtttttaatggacaattaggacttataattaaacttgattttgaagagagtaaa
tgtatagttttatatccaaatgatgatatggtagtattttatgactttgatgatttggat
tcattattatccttagcgtattgtttaaccatacataaaactcaaggtatggagtatgat
aatgctcttattcctatgagtttttcccattatattatgcataatacaaagctattatat
acagcaattacaagggctaaaagcatgtgttatatcgtaggagaagaagatgcttttaag
ggtgcttgtaaaagaattgagactacaaaacgagaatctgtgataaatgacctattaagc
taa

DBGET integrated database retrieval system