KEGG   Arcobacter nitrofigilis: Arnit_2385Help
Entry
Arnit_2385        CDS       T01235                                 

Definition
peroxiredoxin (EC:1.11.1.15 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Arnit_2385
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Arnit_2385
Enzymes [BR:ant01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Arnit_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2376971..2377516)
Genome map
AA seq 181 aa AA seqDB search
MSIYDFKVKDAYGNIVNLDKYKGKVLLIINSATECGFTSQYEGLQLLYEKLKGEKFEIID
FPCNQFGNQAPGTNAEIASFCNSRFGIQFPIFGKIDVNGNNAEPLFSYLVGQKGFEGFDA
KHPLSKGLDEMLAKVDPNYKNDPSIKWNFTKFLIDKNGNVVTRFEPTVDIEVIEEQINAL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttacgattttaaagttaaagacgcttacggtaatattgtcaatttagataaa
tataaagggaaggttttgttaattattaattctgcaactgagtgcggatttacttctcaa
tatgaagggttacaactattatatgaaaaattaaaaggtgaaaaatttgaaataattgat
tttccttgcaatcagtttggtaatcaagcgccaggaaccaatgcagaaatagcaagcttt
tgtaattcaagatttggaattcaatttccaatttttgggaaaattgatgttaatggtaat
aatgctgaacctctattctcatacttagttgggcaaaaaggatttgaaggatttgatgca
aaacatcccctatcaaagggattggatgaaatgctagctaaagttgatcctaactataaa
aatgatccatctatcaaatggaattttacaaagtttttaattgacaaaaatggaaatgtt
gtaacacgattcgaaccaactgttgacattgaagtcattgaagaacaaatcaatgcactc
ctataa

DBGET integrated database retrieval system