KEGG   Arcobacter nitrofigilis: Arnit_2411Help
Entry
Arnit_2411        CDS       T01235                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00790  Folate biosynthesis
ant01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arnit_2411
Enzymes [BR:ant01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Arnit_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha DUF3638 RestrictionSfiI
Motif
Other DBs
NCBI-ProteinID: ADG94062
UniProt: D5V1A0
Position
complement(2408047..2408619)
Genome map
AA seq 190 aa AA seqDB search
MKDEKKFEDAIKSVLEYVGEDVTREGLEKTPSRVRKAFDFMCSGYKQDPKEIINSALFTS
SNDEMVVIKDIEFYSMCEHHMLPIIGKAHVAYIPNGKVVGLSKIPRVVDVFARRLQIQEQ
MTEQICDALHEALNPKGVAVMIDARHMCMEMRGVEKICSTTVTSALRGLFKKEKKTKDEF
LSIVAQSLHK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgaaaaaaaatttgaagatgcaataaaaagtgtacttgaatatgtaggggaa
gatgtaactagagaaggcttagaaaaaactccaagtcgtgtgagaaaagcttttgacttt
atgtgtagtggatataaacaagacccaaaagagataattaattcagcactttttacaagt
tcaaatgatgaaatggttgttataaaagatatagaattttattctatgtgtgaacatcat
atgttgccaattattggaaaagcacatgtggcatatatcccaaatggaaaagtagtagga
ctttcaaagattccaagagttgttgatgtatttgcaagaagattacaaattcaagaacaa
atgacagaacaaatctgtgatgctttacatgaagccctaaatccaaaaggtgtggctgtt
atgatagatgcaagacatatgtgtatggagatgagaggagtagaaaagatttgttctact
actgttacttcagcgcttagaggactctttaaaaaagagaaaaaaacaaaagatgagttt
ctatcaatagtagctcaatctttacataaataa

DBGET integrated database retrieval system