KEGG   Arcobacter nitrofigilis: Arnit_2411Help
Entry
Arnit_2411        CDS       T01235                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ant  Arcobacter nitrofigilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arnit_2411
Enzymes [BR:ant01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Arnit_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2408047..2408619)
Genome map
AA seq 190 aa AA seqDB search
MKDEKKFEDAIKSVLEYVGEDVTREGLEKTPSRVRKAFDFMCSGYKQDPKEIINSALFTS
SNDEMVVIKDIEFYSMCEHHMLPIIGKAHVAYIPNGKVVGLSKIPRVVDVFARRLQIQEQ
MTEQICDALHEALNPKGVAVMIDARHMCMEMRGVEKICSTTVTSALRGLFKKEKKTKDEF
LSIVAQSLHK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgaaaaaaaatttgaagatgcaataaaaagtgtacttgaatatgtaggggaa
gatgtaactagagaaggcttagaaaaaactccaagtcgtgtgagaaaagcttttgacttt
atgtgtagtggatataaacaagacccaaaagagataattaattcagcactttttacaagt
tcaaatgatgaaatggttgttataaaagatatagaattttattctatgtgtgaacatcat
atgttgccaattattggaaaagcacatgtggcatatatcccaaatggaaaagtagtagga
ctttcaaagattccaagagttgttgatgtatttgcaagaagattacaaattcaagaacaa
atgacagaacaaatctgtgatgctttacatgaagccctaaatccaaaaggtgtggctgtt
atgatagatgcaagacatatgtgtatggagatgagaggagtagaaaagatttgttctact
actgttacttcagcgcttagaggactctttaaaaaagagaaaaaaacaaaagatgagttt
ctatcaatagtagctcaatctttacataaataa

DBGET integrated database retrieval system