KEGG   Arcobacter nitrofigilis: Arnit_2452Help
Entry
Arnit_2452        CDS       T01235                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ant  Arcobacter nitrofigilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arnit_2452
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arnit_2452
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arnit_2452
Enzymes [BR:ant01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arnit_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2447603..2448343)
Genome map
AA seq 246 aa AA seqDB search
MKKLVGYITAALPENNFTVDLALNMKDAGVDILELGIPFTDPVADGPVIEKANLIALKNG
FKLKDLFEVSSKIAPEMKTLWMGYANPFYHYGIEKFFAKAQEFGIKGAIVPDFPFEESLK
YNKLASHYEQALISFVAPTHSENRIKKVVEHSKEFVYMVAYAGITGSGVEEDLSDIIDNV
RKYTKTPLYIGFGVDEKTAKAKAKNVDGVIVGSAFVKHLIDDSLSNSEKIQRITAIAKEI
KEKINE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaacttgttggatatattacagcagcattgcctgaaaacaattttacagtagat
ttagctttaaatatgaaagatgcaggcgttgatattttagaattaggtattccttttact
gatccagtagccgatggtccagtgattgaaaaagcaaatttaatagccttgaaaaatggc
tttaaattaaaagatttatttgaagtttcaagtaaaattgctcctgagatgaaaacattg
tggatgggttatgctaatcctttttatcattatggaatagaaaagttttttgcaaaagca
caagagtttggaataaaaggtgctattgttcctgattttccttttgaagagagtttaaaa
tataataaattagctagtcattatgagcaagcgttaatatcttttgtagctccaactcat
agtgaaaatagaattaaaaaagtagttgaacattctaaagagtttgtttacatggtagct
tatgcaggtattactggaagtggagtagaagaggacttaagtgatattattgataatgtc
agaaagtatactaaaactcctttatatattggttttggagtagatgaaaaaacagcaaaa
gcaaaagcaaaaaatgttgatggtgtaatagttggatctgcttttgtaaaacacctaata
gatgatagtttaagtaatagcgaaaaaatccaaagaataactgcaatagcaaaagagata
aaagaaaaaataaacgagtaa

DBGET integrated database retrieval system