KEGG   Arcobacter nitrofigilis: Arnit_2686Help
Entry
Arnit_2686        CDS       T01235                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ant  Arcobacter nitrofigilis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arnit_2686
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arnit_2686
   00640 Propanoate metabolism
    Arnit_2686
   00660 C5-Branched dibasic acid metabolism
    Arnit_2686
Enzymes [BR:ant01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Arnit_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2704125..2705297
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQAKNLYRKYDIPTTKGKLLTHPSQLDDILRSVGKNKWVIKAQVHAGGRGKAGGV
VLVNSKKEANEEVRRLLGSNLVTHQTNAQGQAVNSIYIEEPCEIKDEIYLAFIVDRTSQR
IMIITSSEGGMDIEEVAERFPEKILRNPINPIVGIMPAQCRQICEDLGFDKDLSVQMIDL
MKNIYKMFVQKDLSLVEINPLVVTKDNKLICLDGKVVVDNSALYRQPKMNEIRDDSQEDE
RELKAEKLDLNYVSLDGNIACMVNGAGLAMATMDLIKTHGGEPANFLDVGGSVNEKRVIE
AFEIILSDTKVNGILVNIFGGIVRCDIIAAGIIGAAEKMNINIPIVVRLEGTNAKEGLEL
IKNSNVTVYEEADLDKAALKIIELSNKGAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaagcaaaaaacttatatagaaaatacgacattcctactaca
aaagggaaacttttaactcacccctctcaactagatgatatattaagaagcgttggaaaa
aacaagtgggtaattaaagctcaagttcatgcaggtggaagaggaaaagctggtggagtt
gttttggttaattccaaaaaagaagcaaatgaagaagtaagaagattattaggaagtaat
ttagttactcaccaaacaaatgcccaaggacaagctgtaaattctatttacatagaagag
ccttgtgagataaaagatgaaatatacttagcctttattgttgatagaacaagtcaaaga
attatgataattacttctagtgaaggtggtatggatattgaagaagtagcagagcgattt
cctgaaaagattctaagaaatccaataaaccctattgttggaataatgccagctcaatgt
agacaaatctgtgaagacctaggttttgacaaagatttaagtgttcaaatgatagatttg
atgaaaaatatttataaaatgtttgtacaaaaagatttatctctagtagaaataaatcct
ttagttgtaacaaaagataataaacttatttgtttagatggaaaagttgtagttgataat
tcagccctttatagacaacccaaaatgaatgagataagagatgattcacaagaagatgaa
agagaactaaaagctgaaaaactagatttaaattatgtaagtttagatggaaatattgct
tgtatggtaaatggtgctggtttggcaatggcaactatggacttaatcaaaacccatggt
ggagaacctgcaaacttccttgatgttggtggaagtgtaaatgaaaaaagagttatagaa
gcctttgaaattattctttctgatacaaaagtaaatggtatcttagtaaatatttttggt
ggaattgtaagatgtgatattatcgcggctggtattattggagcggctgaaaagatgaat
ataaatattcctattgtagtaagacttgaaggtacaaatgcaaaagaaggacttgaattg
ataaaaaattcaaatgtaacagtttatgaagaggctgatttagataaagctgcattaaaa
atcattgaactatcaaataaaggagctaaataa

DBGET integrated database retrieval system