KEGG   Arcobacter nitrofigilis: Arnit_3021Help
Entry
Arnit_3021        CDS       T01235                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ant  Arcobacter nitrofigilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3052346..3053380
Genome map
AA seq 344 aa AA seqDB search
MKKFVLTSTLVLFSAVSLFGMTDSSLLEKAKNSGLKAIPKSELEILKLVDDPNNPITAKK
VELGKKLYFEPRLSKSGLISCNTCHNLAMGGVDGVSAAIGHKWTANPHHLNSPTVYNSVL
NKVQFWNGRSPHLEDQAQGPIQAGPEMAAPSKLVVNRVTSMKGYVDEFKDTYGDNVKIDF
KLIADTIAVFERTLITPSRYDDFMNGNLSSLSKEEKKGLNLFIDKGCIGCHNDIGLGGTM
QPFATAAKYKFANLGDFKGDKNRMVKTPTLRNIEETAPYFHNGGVWSLKEAVKVMGSTQL
GLKISDNDAKEIVTFLKSLTGEKPKITYPILPIATKTTPKPDMN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttgtattgacaagtaccctagtgcttttttcagccgtaagtttgtttgga
atgacagattcttctttgttagaaaaagcaaagaattcaggtttaaaagcaattccaaaa
agtgagttagagattctaaaattggtagatgaccctaataatcctattacagctaaaaaa
gttgaattaggtaaaaaactttattttgagccaagattatcaaaaagtggtcttatctca
tgtaatacctgccataatttagcaatgggtggagtagatggagtttcagctgctattgga
cataaatggacagcaaatcctcatcacttaaactccccaactgtttataactctgtttta
aataaagtacagttttggaatggtagatctccacacttagaagatcaagctcaaggtcct
attcaagcaggtccagaaatggcagcaccttcaaaacttgttgtaaatagagttacatct
atgaaaggttatgttgatgagttcaaagatacttatggagataatgtaaaaattgatttt
aaacttatcgcagatactattgctgtatttgaaagaacacttattacaccttcaagatat
gatgattttatgaatggaaatctatcatcactatcaaaagaagaaaaaaaaggtctaaat
ttatttattgacaaaggatgtattggatgtcacaatgatattggattgggtggaactatg
caaccatttgcaacagccgctaaatacaaatttgctaatttaggtgattttaaaggagat
aaaaatagaatggttaaaactccaactttgagaaacattgaagagacagccccttatttt
cataatggtggagtttggtctttaaaagaagcagtaaaagtaatgggttctactcaacta
ggtttaaaaatttctgataatgatgcaaaagaaatagtaacttttcttaaatcacttaca
ggtgaaaaacccaaaattacatatccaattctccctattgctacaaaaacaacaccaaaa
ccagatatgaattaa

DBGET integrated database retrieval system