KEGG   Arcobacter nitrofigilis: Arnit_3148Help
Entry
Arnit_3148        CDS       T01235                                 

Definition
formyl transferase domain-containing protein
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
ant  Arcobacter nitrofigilis
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ant00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Arnit_3148
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Arnit_3148
Enzymes [BR:ant01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Arnit_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3190095..3190670)
Genome map
AA seq 191 aa AA seqDB search
MKRIGILSSHNGSGFDTLLEACENKTLDAQVVLVISNNQEAKVLEKASKNHVPNFVVNAK
KYPDENLDEKITKLMLEFKVDYIFLSGYMKKIEENLLKNFPNKIINSHPALLPKFGGKGM
YGKFVHEAVIKEKDKQSGCTIHLVNENYDEGKYILQEKVSLSSDETIETLENKIKNLEKE
TIIKAFKKMLS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattggaatactctcttcacacaatggaagtggatttgatacacttttagaa
gcttgtgaaaacaaaactttagatgcgcaagtggtattagtaatctctaataaccaagaa
gcaaaagtgttagaaaaagcatcaaaaaatcatgttccaaattttgttgtaaatgcaaaa
aaatatccagatgaaaaccttgatgaaaaaattacaaagttgatgcttgaattcaaagtt
gattatatatttttatcaggatatatgaaaaaaatcgaagaaaaccttttaaaaaatttc
ccaaataaaatcataaattcccatcctgccttattaccaaaatttggtgggaaaggtatg
tatgggaaatttgtacatgaggctgttataaaagaaaaagataaacaatcaggatgtaca
atacatttagtaaatgaaaattatgatgaaggtaaatatatacttcaagaaaaggtttct
ttatcaagtgatgagactatagaaactttggaaaataaaataaaaaatttagagaaagaa
actattataaaagcatttaaaaaaatgttaagttga

DBGET integrated database retrieval system