KEGG   Acholeplasma oculi: Aocu_06470Help
Entry
Aocu_06470        CDS       T03695                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aoc  Acholeplasma oculi
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:aoc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aocu_06470 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    Aocu_06470 (fadI)
   00640 Propanoate metabolism
    Aocu_06470 (fadI)
   00650 Butanoate metabolism
    Aocu_06470 (fadI)
  Lipid metabolism
   00071 Fatty acid degradation
    Aocu_06470 (fadI)
   00072 Synthesis and degradation of ketone bodies
    Aocu_06470 (fadI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aocu_06470 (fadI)
   00310 Lysine degradation
    Aocu_06470 (fadI)
   00380 Tryptophan metabolism
    Aocu_06470 (fadI)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aocu_06470 (fadI)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aocu_06470 (fadI)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Aocu_06470 (fadI)
Enzymes [BR:aoc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Aocu_06470 (fadI)
Exosome [BR:aoc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aocu_06470 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:714963..716171
Genome map
AA seq 402 aa AA seqDB search
MKKVYVVAANRSPIGSFLGTLSKISPAEFGAQVLSKMLAKHQIDPSIIDEVIIGNVLPAG
QKQGLARQVSILSGIHESVPAYSVNMICGSGMKSVINAFSNIQAGIADVVVAGGVESMSQ
APFLVDGSIRQGVKMGNMNLVDYMLTDGLTDAFGNYHMGITAENIVEKHQFTRQMQDEFA
YNSQLKAREALKQGKFKEEIIPIVIKDRKGEIVFSEDEYINHTTTLEKIAALKPAFKKDG
TVTAASSSGINDGASFIVIASEDAIKKHHLTPLFEVIGVGQAGVDPSVMGLGPVPAIEKS
LVFAGIRIQDIDIFELNEAFAAQALGVVREVSEKYQVTEDSILDKTNPNGGAIALGHPVG
ASGNRIMVTLMHEMLRNKDQKIGLASLCIGGGMGTSVILRKV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatatgttgtagctgcaaatagaagtccaattggttcttttttaggaacc
ttatcaaaaattagtcctgctgagtttggggcacaagtattaagtaaaatgttggctaag
catcaaattgatccttcaataatcgatgaagttatcattggtaatgtattaccagctggc
caaaaacaaggtctagcaagacaagtctctattttatcaggtattcatgaatcagttcct
gcttatagtgtaaatatgatatgtggatccggtatgaagagcgtaataaatgctttttca
aatattcaagcaggtatagcggatgttgtagttgcaggtggtgtcgaatcaatgagccaa
gcaccttttttagtggatggttcaattagacaaggggttaagatgggcaacatgaatttg
gttgattacatgttaacagatggccttactgacgcattcggaaactatcatatgggaatc
actgctgaaaacattgttgaaaaacatcagtttacaagacaaatgcaagatgaatttgca
tataactctcaacttaaagcaagagaagcattaaaacaaggtaaatttaaagaagaaatt
attcctatcgtcatcaaagatcgtaaaggcgaaatcgtattttctgaagatgaatacatt
aaccacactacaacattagaaaagatagcagcattaaaacctgcatttaaaaaagatgga
acagtaactgcagcatcttcatcaggtattaatgatggagcatcatttattgtcattgca
agtgaagatgcaattaagaaacatcatctgactcctttgtttgaagtgattggagttgga
caggcaggtgttgatccaagcgtcatgggattaggacctgttcctgcgattgaaaaatca
ttagtttttgctggaatacgcattcaggatattgatatttttgaactgaatgaagccttt
gctgctcaagctttaggggtagtcagagaagtcagtgaaaaatatcaagtaactgaagac
tcaatacttgataaaacaaatcctaatggtggtgcaatagcattaggtcacccagtagga
gcatcaggtaatagaattatggtaacactgatgcatgaaatgttaagaaataaagatcaa
aaaattggacttgcaagtctatgtattggtggcggaatgggaacttcagtcatcttaaga
aaggtataa

DBGET integrated database retrieval system