KEGG   Alkaliphilus oremlandii: Clos_0143Help
Entry
Clos_0143         CDS       T00607                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aoe00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:aoe00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aoe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
168749..170329
Genome map
AA seq 526 aa AA seqDB search
MLKDSKMSRRLIAPIVCLVMLLSFTAGSAMNSKSSLGMNFAEAGTLSNIQVEGKTPKYIF
MFIGDGMAAVQVNSAQIYKGNNNHNQIALQEVNFQDFEAVGYQTTHDATSFAPDSASTAT
SLSSGFKTWSGTIGLRPVGGISANKVENVDINKVPKTIAERLKDEKGMKIGIISTVTINH
ATPAAYYAHIPSRNDYYDIAMQMADSNFDYFGGGTISQPTGKNKDQRDAYEVLEEKGYKI
ARTKEEILGLNSSSGKVYAVTPVTQDGGAMPYAIDSKEGDLALADFVKKGIDVLDNEKGF
FMMAESGKIDWAGHANDAKANIGDVLAFADAVQVAIDFAKEHPEETLIIVTGDHETGGMT
IGQATTGYDTAVNILENQKISYIEFDKIIDGMKDKKPNLTFEEVLPVITENFGLKDEYVD
GEGDQPYMALELSNSEVKRLKTAFSETMAKERTKNEETALLYGGYNPLSVTLTHILNNKA
GIGWTSYAHTGVPVPVYATGVQAKLFNGAYDNTEVYHKLVAATKLQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggattctaaaatgtctagaagattaattgcaccgattgtctgtttggttatg
ctattatcatttacagcaggctcagcaatgaacagcaaatcatcattaggaatgaatttt
gcagaagcaggaaccttgagcaatattcaagtagaaggtaagactcctaagtacatattt
atgtttattggagatggtatggctgcggtacaagtaaattcagctcaaatttataagggg
aataacaatcacaatcaaattgctttacaagaagttaactttcaggatttcgaagctgta
ggatatcaaacaactcatgatgcaacctcctttgctccagactctgcatctacagcaacc
tctctatcatccggatttaaaacatggagtggaactattggattaagaccagtaggaggt
atatctgcgaacaaagtagaaaatgtggatataaataaagtaccgaaaaccatagctgaa
aggctaaaagatgagaaaggtatgaagatcggtatcatatctacagtaaccatcaatcat
gctacaccagcagcatattacgcccacatcccttcaagaaatgattattatgatatcgct
atgcaaatggcagattctaactttgattactttggtggtggaactataagccaaccaaca
gggaaaaataaagatcaaagagatgcgtatgaggttttagaggaaaaaggatataaaata
gcaaggacaaaggaagaaattctaggtcttaatagcagctctggtaaagtgtatgcagtt
actccagttactcaagatggaggagctatgccgtatgctatagatagtaaagaaggcgat
ttagccttagcggattttgtgaaaaaaggaatcgatgttcttgataatgaaaaaggcttt
ttcatgatggctgaatcaggaaagattgactgggcaggacatgcaaatgatgcgaaagca
aatattggggatgttctagcctttgctgatgcagtacaagtggcgatagattttgcaaaa
gaacatccagaagaaacattaatcatagtaactggagatcatgaaacaggtggtatgact
atagggcaagcaacaacggggtatgacacagcagtaaatattttagaaaaccaaaagata
agttatatagaattcgataaaataattgatggtatgaaggataaaaagccaaatttaaca
tttgaggaagtattgccagttataactgaaaactttggtttaaaggatgagtatgtggat
ggtgaaggggatcaaccttacatggctctagagctatcaaattcggaagtaaaaagattg
aaaacagcgttttcagaaacaatggcaaaagaacgaactaaaaatgaagaaacagcttta
ttatatgggggctacaatccactttcagtaacgttaactcatatcttaaataacaaagca
gggattggttggacttcatacgctcacaccggggtacccgtaccagtatatgctacaggg
gtacaagctaagctgttcaatggagcatatgataacacagaagtataccataagctagta
gccgctactaagcttcaataa

DBGET integrated database retrieval system