KEGG   Alkaliphilus oremlandii: Clos_0227Help
Entry
Clos_0227         CDS       T00607                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00220  Arginine biosynthesis
aoe00330  Arginine and proline metabolism
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
aoe01130  Biosynthesis of antibiotics
aoe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Clos_0227
   00330 Arginine and proline metabolism
    Clos_0227
Enzymes [BR:aoe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Clos_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABW17790
JGI: Clos0227
UniProt: A8MKX3
Position
complement(261460..262359)
Genome map
AA seq 299 aa AA seqDB search
MKINLIGVPLTYGCGKDGAQYGPSVLRENNMIDLIKNNGHTLYDLGDLVIPPASEEDQFK
GHENIKYLDLITEVNTNLAHQVYCSLEGESFPFVIGGDHSLGMGSIAGISKHFNEVAVIW
IDAHSDINTHLTSPSGNPHGMPLAASMGVGHPKFTDIYFKGQKVHPKNVYIIGVRDPDAG
ELALVDDLNLSYYSMKTVREKGLENVLNEVIENIKGSGVDGVHISYDIDVFDKSIVPGTG
TPVADGFTLEEGKFTIETLLKEKFVTSMDFVELNPLLDDASKTTVKTAVEFLNHTFKCL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatttaatcggtgtacctcttacgtacggttgtggtaaagatggcgcacaa
tatggtcctagtgttcttagagaaaataatatgatagatttgattaaaaataatggtcat
acactttatgatttgggggacttagtcattcctcctgcttctgaagaggatcaatttaaa
ggtcatgaaaacattaaatatttagatttaataaccgaggtaaatacaaacttagcacac
caagtgtactgctctcttgaaggcgaaagcttccctttcgtcatcggaggtgatcactct
ttaggaatgggtagtatcgctggaatcagcaagcacttcaatgaagttgcggtcatatgg
attgatgctcacagtgatattaacacccatttaacttctccatctggcaaccctcacggt
atgcctttagcagcatccatgggcgtcggtcatccaaagtttacggatatctattttaaa
ggccaaaaggttcatcctaaaaatgtttacatcatcggtgttcgggaccctgacgctggt
gaattggctttagtagatgatctgaacctttcttactacagcatgaaaactgtgagagaa
aagggattggaaaatgttttaaatgaagtgattgaaaatatcaaaggttctggcgtagat
ggcgttcatatcagctatgatatcgatgtattcgacaaatcgatcgttcctggtactgga
actcccgtagccgatggttttactttagaagaaggtaagtttaccattgaaacgctttta
aaagaaaaattcgtaacttcaatggacttcgtagagctgaacccattgctggatgatgca
tctaaaactacagtaaaaactgcagttgaattcctaaaccacacttttaaatgcttataa

DBGET integrated database retrieval system