KEGG   Alkaliphilus oremlandii: Clos_0585Help
Entry
Clos_0585         CDS       T00607                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clos_0585
   01230 Biosynthesis of amino acids
    Clos_0585
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clos_0585
   00030 Pentose phosphate pathway
    Clos_0585
   00051 Fructose and mannose metabolism
    Clos_0585
   00052 Galactose metabolism
    Clos_0585
  Energy metabolism
   00680 Methane metabolism
    Clos_0585
Enzymes [BR:aoe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clos_0585
Protein phosphatases and associated proteins [BR:aoe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clos_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
647384..648343
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRSGIYNEMKVMGVKQGYNGLINAQIEEMNLSSVADI
IHRGGTILRTARSEEFMTEEGQRKALNVIKVLGIEGIVAIGGDGSIRGAKTLNELGIPTI
GVPGTIDNDLAYTDYTIGFDTSVNTVVDAISKIRDTSTSHGRANIIEVMGRHCGDIALMA
GLAGGAESIIVPEVGVDVDEVCNKLLKGRYRGKLHSIIILAEGAGSAIEMSKEIEEKTGI
ETRATILGHLQRGGSPTASDRILASKLGARAVELLLQDIGNRVVGVHGKNVIDMDIDEAL
SMKSNFDIETYELTKILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgctgtattaaccagcggtggcgatgcaccaggaatgaatgctgcagtc
cgtgctgtagtaagaagcggaatttataatgagatgaaggtcatgggggtaaaacaaggg
tacaatgggttgattaacgctcaaatagaggagatgaatctttcttctgtagcggatatt
atccatcgcggagggaccatcctcagaactgcaagaagcgaagagtttatgacagaggaa
gggcaaagaaaggcactgaatgtcatcaaggttttaggaatcgaggggattgttgcaatc
ggtggagatggttccattcgtggtgcaaagaccctcaatgaactaggaatccctaccatc
ggtgttccgggaaccattgataacgacttggcctatacggactataccataggctttgat
acctctgttaatacagtagtagatgccatcagcaaaatcagggatacttccacatcccat
ggacgagctaatattattgaagttatgggcagacattgcggcgatattgctctgatggct
ggactggcaggaggcgcagaaagcattatcgttcctgaagtcggtgttgatgtggatgag
gtatgcaataagcttttaaagggaagataccgaggaaaactgcatagtatcatcatttta
gcggagggcgccggcagtgcaattgaaatgagtaaggaaattgaagagaaaacagggatt
gaaacgagagcgacaattctaggacacctgcaaagaggtggaagtccaacggcttccgat
cgaattctagccagcaaattgggcgcaagggctgtagaattacttcttcaagatatcggc
aatcgagtggtaggcgttcatggaaagaatgtgatcgatatggatatagatgaagcttta
agtatgaaaagcaattttgatatagaaacctatgaattgacgaagatactatctatttag

DBGET integrated database retrieval system