KEGG   Alkaliphilus oremlandii: Clos_0971Help
Entry
Clos_0971         CDS       T00607                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clos_0971 (tpiA)
   01230 Biosynthesis of amino acids
    Clos_0971 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clos_0971 (tpiA)
   00051 Fructose and mannose metabolism
    Clos_0971 (tpiA)
   00562 Inositol phosphate metabolism
    Clos_0971 (tpiA)
Enzymes [BR:aoe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clos_0971 (tpiA)
Exosome [BR:aoe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clos_0971 (tpiA)
  Exosomal proteins of bladder cancer cells
   Clos_0971 (tpiA)
  Exosomal proteins of melanoma cells
   Clos_0971 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1063715..1064461
Genome map
AA seq 248 aa AA seqDB search
MRKPIIAGNWKMNKVSKEALDLVNQIKDEVHKTEVEVVVCCPFTVLSQVQKALVGTNLKL
GAQNMHWEEDGAYTGEISANMLKDIGVEYVILGHSERRQYFNETDETVNKKVKKAIKENL
KPIVCIGESLEEREANQTFDVIKKQLLGAFEGVPAEAMDNVVLAYEPIWAIGTGKTASSE
EAQTVIAYIRSLIEEKYGVDISEEVRIQYGGSVKASNATEIMNETDIDGALVGGASLKAE
EFLGIINF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaccgattattgctggaaattggaagatgaataaagtatcgaaagaggctttg
gaccttgtaaatcaaataaaagatgaagtacataaaactgaagttgaggttgttgtatgc
tgtccatttactgttcttagccaggttcagaaagcattagtaggaaccaatttaaagcta
ggagcccaaaatatgcactgggaagaagatggcgcttatactggagaaatatcagcgaat
atgttgaaggatattggcgtagaatatgtaatcttaggacattctgaaagaagacagtac
ttcaatgaaacagatgaaactgtgaataaaaaagtgaagaaagccatcaaagaaaatttg
aagccgattgtatgcattggggaaagcttagaagaaagagaagccaatcaaaccttcgat
gtgattaaaaaacaacttttaggggcttttgaaggcgttcctgctgaagccatggacaat
gtggtattagcctacgagccaatatgggcgattggaacaggaaaaacagcatcctctgaa
gaggcacaaacggtaatcgcctatattcgctctttgatagaagaaaaatatggcgtagat
atttcagaagaagttagaattcagtacggtggcagtgtgaaagcatccaatgctacagag
attatgaatgaaacggatattgatggtgcattagttggtggtgcaagcctaaaggcagag
gagtttttaggaatcatcaatttctag

DBGET integrated database retrieval system