KEGG   Alkaliphilus oremlandii: Clos_0971Help
Entry
Clos_0971         CDS       T00607                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00010  Glycolysis / Gluconeogenesis
aoe00051  Fructose and mannose metabolism
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
aoe01120  Microbial metabolism in diverse environments
aoe01130  Biosynthesis of antibiotics
aoe01200  Carbon metabolism
aoe01230  Biosynthesis of amino acids
Module
aoe_M00002  Glycolysis, core module involving three-carbon compounds
aoe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clos_0971
   00051 Fructose and mannose metabolism
    Clos_0971
   00562 Inositol phosphate metabolism
    Clos_0971
Enzymes [BR:aoe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clos_0971
Exosome [BR:aoe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clos_0971
  Exosomal proteins of bladder cancer cells
   Clos_0971
  Exosomal proteins of melanoma cells
   Clos_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ETF MreB_Mbl MurB_C DUF1002
Motif
Other DBs
NCBI-ProteinID: ABW18518
JGI: Clos0971
UniProt: A8MFY0
Position
1063715..1064461
Genome map
AA seq 248 aa AA seqDB search
MRKPIIAGNWKMNKVSKEALDLVNQIKDEVHKTEVEVVVCCPFTVLSQVQKALVGTNLKL
GAQNMHWEEDGAYTGEISANMLKDIGVEYVILGHSERRQYFNETDETVNKKVKKAIKENL
KPIVCIGESLEEREANQTFDVIKKQLLGAFEGVPAEAMDNVVLAYEPIWAIGTGKTASSE
EAQTVIAYIRSLIEEKYGVDISEEVRIQYGGSVKASNATEIMNETDIDGALVGGASLKAE
EFLGIINF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaccgattattgctggaaattggaagatgaataaagtatcgaaagaggctttg
gaccttgtaaatcaaataaaagatgaagtacataaaactgaagttgaggttgttgtatgc
tgtccatttactgttcttagccaggttcagaaagcattagtaggaaccaatttaaagcta
ggagcccaaaatatgcactgggaagaagatggcgcttatactggagaaatatcagcgaat
atgttgaaggatattggcgtagaatatgtaatcttaggacattctgaaagaagacagtac
ttcaatgaaacagatgaaactgtgaataaaaaagtgaagaaagccatcaaagaaaatttg
aagccgattgtatgcattggggaaagcttagaagaaagagaagccaatcaaaccttcgat
gtgattaaaaaacaacttttaggggcttttgaaggcgttcctgctgaagccatggacaat
gtggtattagcctacgagccaatatgggcgattggaacaggaaaaacagcatcctctgaa
gaggcacaaacggtaatcgcctatattcgctctttgatagaagaaaaatatggcgtagat
atttcagaagaagttagaattcagtacggtggcagtgtgaaagcatccaatgctacagag
attatgaatgaaacggatattgatggtgcattagttggtggtgcaagcctaaaggcagag
gagtttttaggaatcatcaatttctag

DBGET integrated database retrieval system