KEGG   Alkaliphilus oremlandii: Clos_1002Help
Entry
Clos_1002         CDS       T00607                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clos_1002
Enzymes [BR:aoe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Clos_1002
Exosome [BR:aoe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clos_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1104329..1105843
Genome map
AA seq 504 aa AA seqDB search
MKKYVMALDQGTTSSRAILFDYEGKIVATSQKEFTQIYPKAGWVEHDPMEIWGTQSGVAR
EVLERMAISPQDIAAIGITNQRETTIVWDKNTGKPVYNAIVWQCRRTAAICDELKTQGMA
DYIRENTGLVLDAYFSGTKIKWILDHVEGAKEKAEKGELLFGTVDSWLIWNLTRGKVHVT
DYSNASRTMLYNIKQLKWDDKILKALEIPKSMLPEVKESSAIYGYTDHQTFGGADIPIAG
AAGDQQAALFGQGCFKEGMGKNTYGTGCFMLMNTGDQFVQSKNGLLTTLAWGIDGKVEYA
LEGSIFVAGASVQWLRDELKIIRDAEDTEYLAKKVPNSNGVYVVPAFTGMGAPYWDMYAR
GAIVGLTRGAKAEHIIRATLESIAYQTRDVLEAMEQDSGIQLKSLKVDGGAAMNNFLMQF
QADILSVPVDRPKITETTALGAAYLAGLAVGFWKDKNEIESKWSVDTVFEPGMDHEEKER
LYKGWKRAVNRALKWEEENELDVK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaatatgtaatggcactggatcaaggtaccaccagttcaagagcaatattattt
gactatgaaggaaaaatcgtggcaacttcccaaaaggagtttacgcaaatttatccaaag
gcaggctgggtagagcatgaccccatggagatatgggggactcaaagcggtgtagcccga
gaggttttagaaaggatggcgattagccctcaagatattgcagccatagggattacgaat
caaagagagaccaccattgtatgggataaaaatacagggaaaccggtgtacaatgcaatt
gtttggcagtgcaggcgaacggcagctatctgtgatgaattaaagacacaagggatggcg
gactatattagagaaaatacaggtttagtcctagatgcttatttctcaggaactaaaatc
aaatggattctggatcatgtagagggtgcaaaagaaaaagcagagaagggagaattgcta
tttggaacagtagatagctggttaatctggaatttaaccaggggaaaagtccacgtaacg
gattattctaatgcttcaagaaccatgctctataatataaagcagctaaaatgggatgat
aagatactaaaggcactagagattccaaaatctatgcttccagaagtgaaggaatccagt
gcgatatacggatacacagatcatcaaacttttggtggcgcagatattcctattgctgga
gccgcaggagatcaacaagcagctttatttggtcagggttgttttaaagagggaatgggt
aaaaatacttatggtacaggatgctttatgctaatgaatacaggggatcagttcgtacaa
tctaaaaatgggttgttgaccactttggcatgggggatcgacgggaaggtagaatacgct
ttagaaggaagtatttttgttgctggagcgtcggttcagtggctgagagatgaactgaaa
attatacgagatgcagaggatacggaatatttagcaaaaaaagtacccaattccaacggt
gtttatgtcgtacctgctttcacaggcatgggcgcaccttattgggatatgtatgcaaga
ggtgcaattgtaggtcttacaaggggagcaaaggcggagcatattattcgagcaacctta
gaatccatcgcttatcaaacgagggatgttttggaggctatggagcaggattcgggaatt
caactaaagtcgttgaaagtagatggcggtgccgccatgaataattttttaatgcaattt
caggcagatatcttatctgttccagtagatcgtcctaagataacagaaacaactgcgtta
ggagcggcatatttagcaggtttggcagtaggattctggaaggataaaaatgaaattgaa
agcaagtggagtgtagatactgtatttgaaccagggatggaccatgaggaaaaagaaaga
ttatataagggatggaagcgggcagtaaaccgtgctttgaaatgggaagaggagaatgaa
ttggatgtcaaatag

DBGET integrated database retrieval system