KEGG   Alkaliphilus oremlandii: Clos_1318Help
Entry
Clos_1318         CDS       T00607                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
aoe  Alkaliphilus oremlandii
Brite
Enzymes [BR:aoe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Clos_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1416757..1419711
Genome map
AA seq 984 aa AA seqDB search
MDLILKGDLPHQQKAIDAINTVFKGVKITKPSLSYMNPSFDINSGIVKENIKEVQKEIHP
SMRGSNEIEDYLNLDIKMETGTGKTYVYTQTIFELHKRYGFNKFIIVVPSLAIKAGTQKF
INSPYVKHHFRETQRYYSEIDLHVLESKKTKKGKNFFPSPVREFVSGSNQVTNKIHVLLT
NMHLLQDRKGSMLVRDDYDYGVEGFYKPSDAMKATKPVVIIDEPHRFARDQKTFEFIENN
VKPQMIIRFGATFPDREVKVGRKKQTVKDYYNLLYNLSSCDAFNQNLIKGVSKEHFEPIS
KKQDKVKIVSVNNKTSVNIQYIKEGEKTITHTLAKDEPLSIITSSFEGVYITGIGKNFIE
LSNGQIKYQGEEFTTDIYSSSYQEQMIKLALERHFETEKENFNRKFKIKTLALFFIDDIY
SYRKDEKTGKETYLKNTFERLLKEKIDMELSSLTEIDSEEYKNYLLASKKDIDATHAGYF
AQDNSDSDEAIAQEVNEILFQKEKLLSIKNEDGSYNTRRFLFSKWTLKEGWDNPNIFTIT
KLRSSGSENSKLQEVGRGLRLPVDEFGNRISNEEFFLNYIVDFTERDFAEELVRQINSEL
PEILVLTDEDIEKVAKKLRIDPDDLFLELLTKKYIDRNKKVNVEKKDEFIEEYLDFVGGL
NKGKVKDSNKNKPQPVKIRKSNYAELKELWEILNQKYFIYYEKLEEEFIEEQLVELLKKD
VFTDVIIASKRDIVRGSENGMVIGESAGVYYTLEKPLPYFEFLRRVNEGTNLPITAIHKA
IVKFSKEHSIEDKYFNEYSAANLINSFEVWKTQNLQGRFSYKKTSLPIHPTPLTNKDGTP
KDVISQGRIGTKIVPGEAMDKYLYDAIAYDSELEKDNIQSQIDEVVVFGKIPRNSIRIPT
INGGTYSPDFMYVVKKKDGSKELNVVVETKDVENENVLRGIEEDKINSAKVFFEQLKLDG
YEVKFETQLKSKKMKSIIDELLSS
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggacttaatactaaagggggacttgccccatcagcaaaaggctatcgatgccatcaat
acagtttttaaaggtgtaaaaattacaaagcctagtctatcctatatgaatccttccttt
gatattaacagtggtattgttaaagaaaatattaaagaagttcagaaagaaatacatcct
tccatgaggggaagtaatgagatagaagattatcttaacctagatattaaaatggagact
ggaacaggtaaaacctatgtatatacccaaactatatttgagcttcataaaaggtatggt
tttaataaatttattattgttgtaccttcattggcaattaaagctggtactcagaagttt
attaattccccatatgtaaaacatcactttagagaaactcaaagatattattcggaaatt
gatttacatgttttagagtcgaagaaaacaaagaaaggaaaaaactttttcccctcacct
gtaagagaatttgttagtggttccaatcaagttactaacaaaatccatgtacttcttacg
aatatgcacctattgcaagatagaaaagggtctatgttagttcgggacgattatgattat
ggtgtagaaggtttttataaaccaagtgatgctatgaaagctactaaaccagttgtaatt
atagacgagcctcacagatttgctagggatcagaagacctttgagtttattgaaaataat
gttaaacctcaaatgattattcgatttggggctactttcccagatagagaagttaaagta
ggaaggaagaaacaaactgtaaaagattattataatttactatataatctaagctcctgc
gatgcctttaatcaaaatctgatcaaaggagtaagtaaagagcattttgagccaatatcc
aaaaaacaagataaggtaaaaattgtatctgttaataataagacttctgttaatattcaa
tacattaaagaaggcgaaaaaaccattactcatactttagcaaaggatgaacctttgtct
attattacttcatcattcgaaggcgtttatattactggtattggtaaaaattttattgag
ttatctaatggccagattaaatatcaaggagaagaatttactactgatatttattcttct
tcctatcaagagcaaatgattaagctcgctttagaacgccatttcgaaacggagaaagaa
aactttaatagaaaatttaagattaaaaccctagctttattctttatagatgatatttac
tcctataggaaagatgagaaaactggcaaggaaacatacttaaaaaacacctttgaaaga
ttattaaaagaaaaaatagatatggaactatccagccttactgaaattgatagtgaggag
tataaaaactacctcttggcttctaagaaggatattgacgctactcatgctggatatttt
gcacaggataatagtgattcagatgaggctatagctcaagaagtaaatgaaatactattt
caaaaggaaaaattactatccattaaaaatgaagatggaagctataatacgagaaggttt
ttattttctaaatggacattaaaggaaggctgggataatcctaatatctttaccattact
aagctacgatctagtggtagtgaaaacagtaaacttcaagaggttggtagaggattaaga
cttccggtagatgaatttggtaatcgaatctctaatgaagaattctttctaaattatatt
gtggactttactgaaagagactttgcagaagaattagtaagacaaattaatagtgaatta
cctgaaattcttgtgcttacggatgaggatatagaaaaggttgccaaaaaactacgcatt
gatcctgacgatttattcttagagcttttaactaaaaaatatatagatagaaataaaaag
gttaacgtagagaagaaagatgagtttatagaagaatatcttgattttgtaggaggtcta
aacaaaggtaaagttaaggacagtaataaaaataaacctcagcctgtgaaaattagaaaa
agtaattatgctgaattaaaagagctatgggaaattttaaatcaaaaatattttatatac
tatgaaaagctagaagaagaatttattgaagagcagctagtagaattattaaaaaaggat
gtctttacagatgtaataattgcaagtaaaagagacattgtacgaggcagtgagaatggt
atggttataggtgaaagtgcaggggtttattataccttagaaaaaccattaccttacttt
gaatttttacgaagagtaaacgagggaacaaatcttcctattacagctattcataaagct
atagttaaattttctaaggagcactcaatagaagataaatattttaatgaatattctgca
gcaaatttgattaatagttttgaggtatggaagactcaaaatttacaaggaagattcagt
tataaaaagacgagcttacctatacatcctacccctttaactaataaagacggtacacct
aaagatgttatttctcagggtcgaataggtacaaaaatagtaccaggtgaagctatggat
aaatacttatatgatgcaattgcttacgattcggaactagaaaaagataatatacaaagt
caaattgatgaggttgttgtatttggtaaaattccaagaaatagcattcgaattcctact
attaacggaggaacctacagtccggactttatgtatgtggtaaaaaagaaagatggtagt
aaagaattaaatgttgtagtagaaaccaaggatgtagaaaatgaaaatgtacttagaggg
atagaagaggataaaatcaatagtgctaaagtattctttgaacagcttaagcttgatgga
tatgaagtaaagtttgaaacccagcttaagagtaagaagatgaagagtattattgatgag
ttgttatcaagttaa

DBGET integrated database retrieval system