KEGG   Alkaliphilus oremlandii: Clos_1423Help
Entry
Clos_1423         CDS       T00607                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aoe00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1531538..1532140
Genome map
AA seq 200 aa AA seqDB search
MSSKGLLIVVSGPSGAGKGTICKELLNQNPQIKVSISATTRQPRNGEIKGINYFFIDKNK
FELMIKNDDFLEYATVYDNYYGTPKEYVMKNLEDGNDVLLEIDIVGALQIKDRFKDAVFI
FILPPSLEELKNRIVGRGTESLADIEKRHGSAISEIEQFIKYDYAVINEDVLKAVGDIEA
IIRAEKCRVLRRTEEIQSKF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaaaggattattaattgttgtatctggtccatccggtgctgggaaaggaaca
atctgtaaggagttattgaatcagaaccctcaaatcaaggtttccatttctgctaccaca
agacaacctagaaatggagaaattaaaggtattaattacttctttatagataaaaataaa
tttgaactgatgataaaaaatgatgattttctggaatatgctacggtgtacgataattat
tacggaacaccaaaagaatatgttatgaagaacctagaagatggcaatgatgtattgtta
gagatcgatattgtcggagctcttcagatcaaagatcgatttaaagatgccgtgtttatt
ttcatcctcccaccatccttagaggaattaaaaaacagaatcgtgggcagaggtacagag
agtctagctgatattgaaaagcgtcacgggtctgctatttcagaaatcgagcagtttatc
aaatacgactatgctgttatcaatgaagatgtattgaaggctgtaggtgatatcgaggcc
atcattagggccgaaaaatgtagagttttaagaagaaccgaggaaatacaatcaaaattt
taa

DBGET integrated database retrieval system