KEGG   Alkaliphilus oremlandii: Clos_1423Help
Entry
Clos_1423         CDS       T00607                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00230  Purine metabolism
aoe01100  Metabolic pathways
Module
aoe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Clos_1423
Enzymes [BR:aoe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Clos_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 MMR_HSR1 AAA_22 ABC_tran RsgA_GTPase Cytidylate_kin dNK AAA_16 T2SSE NTPase_1 Rad17 AAA_17 ADK Bacillus_HBL cobW
Motif
Other DBs
NCBI-ProteinID: ABW18967
JGI: Clos1423
UniProt: A8MH80
Position
1531538..1532140
Genome map
AA seq 200 aa AA seqDB search
MSSKGLLIVVSGPSGAGKGTICKELLNQNPQIKVSISATTRQPRNGEIKGINYFFIDKNK
FELMIKNDDFLEYATVYDNYYGTPKEYVMKNLEDGNDVLLEIDIVGALQIKDRFKDAVFI
FILPPSLEELKNRIVGRGTESLADIEKRHGSAISEIEQFIKYDYAVINEDVLKAVGDIEA
IIRAEKCRVLRRTEEIQSKF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaaaggattattaattgttgtatctggtccatccggtgctgggaaaggaaca
atctgtaaggagttattgaatcagaaccctcaaatcaaggtttccatttctgctaccaca
agacaacctagaaatggagaaattaaaggtattaattacttctttatagataaaaataaa
tttgaactgatgataaaaaatgatgattttctggaatatgctacggtgtacgataattat
tacggaacaccaaaagaatatgttatgaagaacctagaagatggcaatgatgtattgtta
gagatcgatattgtcggagctcttcagatcaaagatcgatttaaagatgccgtgtttatt
ttcatcctcccaccatccttagaggaattaaaaaacagaatcgtgggcagaggtacagag
agtctagctgatattgaaaagcgtcacgggtctgctatttcagaaatcgagcagtttatc
aaatacgactatgctgttatcaatgaagatgtattgaaggctgtaggtgatatcgaggcc
atcattagggccgaaaaatgtagagttttaagaagaaccgaggaaatacaatcaaaattt
taa

DBGET integrated database retrieval system