KEGG   Alkaliphilus oremlandii: Clos_1557Help
Entry
Clos_1557         CDS       T00607                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1667832..1668827)
Genome map
AA seq 331 aa AA seqDB search
MENLNIDLLKKIVSTYSPAGNETRICQLIKKEVEPYADEIYTDALGNLIVRKKGTGKKVL
LAGHMDQIALMVTYVDDKGFLRFTNIGGISPAVTYSQRVIFENGTIGVIGCEKIDSLKDL
TLDKLFIDIGATSKEEAEERVSIGDVCVYYSEVIVDDRHMIAPALDDRIGCYIMIEILKT
MKSSKNDIYFVFTVQEEVGTRGAKTAGYAIEPDVAISFDVTATGDTPKARPMAVQLGHGP
AVKVKDNSILCHPKVKNLMIDNAKKHSIPYQLEVLEFGGTDSGAIHLTRSGVPSGVLSIP
TRYIHSTCEMVSLSDVKQTINLSIKILEEEI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttgaatatagatctactgaaaaaaatcgtcagtacttactctcctgctgga
aatgaaactagaatttgtcagcttattaagaaagaagtagaaccctacgcagatgaaatt
tatactgatgcactgggcaatctaatcgtaagaaaaaaaggaacaggcaagaaggttctt
ttagctggccatatggatcaaattgcattaatggtaacatatgttgacgataaaggtttt
cttcgatttacgaacatcggtggtatatctcctgcggttacatattctcaaagggtaatc
tttgaaaatggcacgattggtgtcatcggatgcgaaaaaatagacagtttaaaggattta
actctggacaaattatttattgatattggtgcaacttctaaggaagaagctgaagaaaga
gtctccatcggggatgtatgtgtatattacagtgaggtgatcgtggacgatcgccatatg
attgcaccagcgctggatgatcgaattgggtgctatatcatgatagagattctaaaaaca
atgaaaagttctaaaaatgatatttattttgtattcaccgttcaagaggaagttggaacg
agaggtgctaaaactgctggatatgcaatagaaccagatgtggcaatatccttcgatgtt
acagctactggagatacaccgaaggcgagaccgatggctgttcaattaggccatggcccc
gctgtaaaagtaaaagataattcgattctttgtcatccaaaagtgaaaaacttgatgatt
gataacgcaaaaaaacattctataccatatcaattggaggttcttgagtttggaggtaca
gactctggagcaattcacttgactagaagcggtgttccatctggggtactatccatccca
acaagatatattcatagtacttgtgaaatggtttcactatccgatgtaaagcaaaccatc
aatttatccataaagatactagaagaagaaatttaa

DBGET integrated database retrieval system