KEGG   Alkaliphilus oremlandii: Clos_1585Help
Entry
Clos_1585         CDS       T00607                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Clos_1585
Enzymes [BR:aoe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Clos_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1691977..1692825
Genome map
AA seq 282 aa AA seqDB search
MELFNNYSFISCNKEFHSADTIIFGAPYDGTSSFRPGSRFASSRIRIDSYGLETYSPYLD
KDLLSRDIHDAGDLDFPFGNRDLVMRYIKEFVTNTIHHNKKTLMIGGEHLVTLPVVEAFH
HKFKDLVVLHFDAHTDLREDYMGEKLSHATVIRRIWDLLGDDRIYQFGIRSGLKEEFEWA
ASGHTTLNKFGYEMLDDVIHTIKDRPVYVTIDLDILDPSIFPGTGTPEPGGISFNDMMRI
ISKLQALNIVGADVVELSPDYDSTGVSTAVASKIIREMLLVL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggagttatttaacaattattcatttatcagctgtaacaaggagtttcattctgcagat
accataatctttggtgccccatatgatggcacaagttctttcaggccgggttctcgtttt
gcttcgagccggattcgaatcgactcttacggcttggaaacctatagcccttatttagat
aaagatcttctctctagagatattcacgatgctggagatttagattttcctttcggaaat
agggatttggtaatgaggtatatcaaagaattcgttacgaatacgatccatcataataaa
aaaaccctaatgatcggtggagagcatctagttacattacctgtagttgaggcatttcat
cataaatttaaggatttagttgtcttacattttgatgcccatacagatttaagagaggat
tatatgggagaaaagctctctcatgccacagtaattaggcgcatttgggacttgcttggc
gatgatagaatctatcaatttggcattcgttctggactgaaagaagagttcgaatgggca
gcatccggtcacaccacattaaataaattcggatacgaaatgttagacgatgtgattcat
accattaaagatcgtcctgtatatgttaccattgaccttgatatattagatccctctatc
tttcctggtactggtactcctgaacccggaggtatttcatttaatgatatgatgcgtatt
atctcaaaactacaagccttgaatattgttggggcagatgtagtggagctttctccagat
tatgattctacaggtgtctctaccgctgttgcctctaaaataattagagaaatgctatta
gtcctatag

DBGET integrated database retrieval system