KEGG   Alkaliphilus oremlandii: Clos_1954Help
Entry
Clos_1954         CDS       T00607                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00260  Glycine, serine and threonine metabolism
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
aoe01120  Microbial metabolism in diverse environments
aoe01230  Biosynthesis of amino acids
Module
aoe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clos_1954
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clos_1954
Enzymes [BR:aoe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clos_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABW19492
JGI: Clos1954
UniProt: A8MI60
Position
2072584..2074071
Genome map
AA seq 495 aa AA seqDB search
METLKYTSTRNHSISVSSVEAIIKGLAEDGGLYVPSCFPPPYALEEIKDLDYKELAVKII
HRFFSDFEQDEICSFVNKAYDGKFHSTEIAPLVKKGEVHFLELFHGPTLAFKDMALTFLP
YLLKGALDKNNLYKEVVILTATSGDTGKAALEGFKNIDGIQIIVFYPTLGVSEIQKKQMM
TQKGHNVHVIGILGNFDDAQNALKEIFNHGEFNRHIEANGYTLSSANSINIGRLIPQIVY
YFYAYFQLVKNKEILMGEPINIAVPTGNFGNILAAYYGMKLGLPIHQFICASNENKVLAD
FFSSGIYDCRRDLKPTISPSMDILISSNLERFLYDLSDENSTFINETMKRLKTEGFYSIP
EYMKEKLTLFYGGSADEEKIYTAIKKVHEQWNYVMDPHTAVAYSVYEDYVHQTKDNTKSI
IVSTASPFKFTKSVCSALHMDVDDKNDFQLIGEFADKMGIPIPLPVKDIHQQENLHNTVC
NKEEIQSIIENILKV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctaaagtatacaagcacgagaaatcactcaatttccgtttcgtccgtcgag
gcaatcataaaaggcttagcggaagatggtggactatatgttccttcttgttttccacca
ccctatgccctcgaagaaattaaagatttagactataaagaacttgcagttaaaattatt
caccgttttttttctgattttgaacaagacgagatttgttcctttgtgaacaaagcatac
gatggtaaattccatagtacagaaatagcacccttggttaagaaaggcgaggttcacttt
ttagaattatttcatggtcctactttagcatttaaagatatggcccttacattccttcct
tatttattaaagggggctttggacaaaaacaacttatataaagaagtggtcatactgact
gctacctctggggatacgggtaaggctgccttagaaggatttaagaatattgatggcatt
cagatcattgtattttatccaaccttaggcgttagcgagatccaaaagaaacaaatgatg
acccagaagggccataatgtacacgttattggtattcttggtaattttgacgatgcacaa
aatgcactgaaggaaatattcaatcatggtgaatttaatcgtcatatagaggcaaatgga
tatacgctctcctccgccaattccatcaacatcggtagattgattcctcaaatcgtttac
tacttctatgcctattttcagttggtaaagaataaagaaatattgatgggggaacccatt
aatattgctgttcctactgggaactttggtaatatattggccgcctactacggtatgaag
ctgggtctaccgattcatcaatttatatgcgcatcgaacgaaaataaggttttggcagat
ttttttagttctggcatatatgattgtcggagagatttaaagcccaccatatccccttca
atggatatcttgatctccagcaatttagagcggttcctatacgatttaagtgatgagaac
tctactttcatcaatgaaaccatgaaaagattaaaaacagagggcttctattcaattcca
gaatatatgaaggaaaagctgactcttttttatggcggttctgccgatgaagagaaaatt
tatactgctataaagaaggttcatgaacaatggaattatgtgatggatccacatacagca
gtggcttactccgtatatgaagactatgtccatcaaacaaaggacaacactaaatcgatc
atcgtatctacggcaagccctttcaagtttacgaaaagtgtatgcagtgctttacatatg
gatgtggacgataaaaatgactttcagctcatcggtgaatttgccgataaaatgggcatc
cctattcctctccctgtgaaagatattcatcaacaagagaatttacacaatacggtatgt
aacaaagaggaaatacagagcattatcgaaaatatattgaaagtgtag

DBGET integrated database retrieval system